]> Achievement Stats » Profiles » FaruSantos

FaruSantos

Completion progress
Loading...
Rank 21584
Achievements 2004 (1712.73 points)
Number of games and DLCs 365
Number of all owning games 448
Badges 237 (31164 XP)
Member since January 11, 2008
Total playing time 1997.0 hours
Completion rate 0.6 %
Location Brasilia, Distrito Federal, Brazil
Real name Farley Santos

Show / hide summary

Achievements

Game Unlocked achievements Locked achievements
Current best # Points Next easiest # Points
1001 Spikes -1 0 0.00 0.9985938668I AM ONLY A MANHerro!A Strange DreamYes, I Can!Dead WalkerGolden BoyOnesan 25 37.62
View unlocking history of this single game only
12 is Better Than 6 -1 0 0.00 0.4898618758The first stepI can shoot!I shoot quite well!Noiseless Mexican...Filcher...good MexicanWhat was written there? 46 37.42
View unlocking history of this single game only
12 Labours of Hercules -1 0 0.00 0.3878519535Gold reserveFirst GoldTricksterManual DexterityJugglerAthleteDiligence 22 12.28
View unlocking history of this single game only
16bit Trader -1 0 0.00 1.4778406620Sea DogA Small ArmyPiousA Brave HeartAn Honest ManBig GunEnlightened Mind 16 25.72
View unlocking history of this single game only
8-Bit Bayonetta 0.6055210233NinjaHigh RollerAddictedBonusBullet BalletZeroBouncy 12 5.43 0.5181958675Unlimited AmmoVery SpecificBayonettaHigh Score 4 2.52
View unlocking history of this single game only
80 Days 1.202134609270 Days20 Cities80 DaysCompleted TripThe World's Fair 5 4.91 1.3060050011No BanksTake That Varmit60 DaysLightweight ChampionThe Ocean FloorSaved from the Noose30 Cities 30 57.08
View unlocking history of this single game only
AaaaaAAaaaAAAaaAAAAaAAAAA!!! for the Awesome -1 0 0.00 0.8410128355I am One in a Million, and There Are Six Thousand People in the World Exactly Like MeI Have Come to The Point in My Life Where I Appreciate Christmas Mall MusicOne Fewer Than a Lewd Innuendo Because We Are Totally Past That PhaseI Have Jumped Beyond the Powers of Two, and Have Lived to Tell the TaleI Have Broken More Glass Than a Finely Corpulent Opera Singer, and Love Myself For ItI am at Risk of Contracting Mononucleosis, Which is Known Colloquially as the Kissing DiseaseOooooOOoooOOOooOOOOoOOOOO!!! -- O Ooooooooo Ooooooooo ooo Ooooooo 10 14.61
View unlocking history of this single game only
Absolute Drift 0.5027768612Hoon Airlines 1 0.50 0.7592819929Jelly DonutsSpin DoctorMaverickGood SkillsBring the Cubic RuckusDrift Line ApprenticeMaster Drifter 19 20.56
View unlocking history of this single game only
Action Alien -1 0 0.00 1.2649463415Journey Routine(Almost) Under ControlCow-BoyRationingDemomanThe 2nd AmendmentWarm Trip 19 29.54
View unlocking history of this single game only
Adventures of Shuggy 0.7597533464Shmu HerderMaster Of Time 2 1.46 0.9579418898Dungeon PerfectionistBoiler Room PerfectionistNinjaCastle ReclaimedGallery PerfectionistGraveyard PerfectionistClock Tower Perfectionist 11 15.65
View unlocking history of this single game only
Aegis Defenders 1.7709767818Master RuinhunterBig SpenderHit Rock BottomDefended AegisReunitedSaved a PrincessSaved a Village, Mostly 28 44.74 1.7947145700MachineThe ClarentDeathless 3 5.40
View unlocking history of this single game only
Agent Awesome -1 0 0.00 1.0935201645Intelligent Life DetectedBig SpenderTottally not racism.Guns don´t kill people ISeriously?Guns don´t kill people IINo more TPS Reports 39 68.10
View unlocking history of this single game only
AI War: Fleet Command -1 0 0.00 0.86771708731. Rainy Day Savings: 50,000 Energy1. Warmup: 1 Hour Campaign5. Maxed Out Resources1. Future Proofing: 150,000 EnergyHeat Wave Brown OutIn The Midst Of A Cold, Dark Winter1. Control 2 322 723.12
View unlocking history of this single game only
Airstrike HD -1 0 0.00 1.0155795813SurpriseStargazerMechanicCombat flightMassive TargetSniperPresent box 12 16.72
View unlocking history of this single game only
Alpha Runner -1 0 0.00 0.7409912944YOU DID NOTHING AWARDGetting StartedYou triedJump AroundWarmed upFun KillerNot again 20 22.69
View unlocking history of this single game only
Amigdala -1 0 0.00 1.2797917128Conspiracy theoristArdentNosyLuxInquisitiveTrouble seekerBookworm 15 26.73
View unlocking history of this single game only
Amnesia: A Machine for Pigs -1 0 0.00 1.4933831692The TeethThe ThroatThe GutThe EntrailsThe HeartMaster ArchivistInsanity 7 11.54
View unlocking history of this single game only
Amnesia: The Dark Descent -1 0 0.00 1.3687452078NOPEAlchemistEscape ArtistDescendantPipeworkerRestorerSurvivor 18 32.51
View unlocking history of this single game only
Ampu-Tea -1 0 0.00 0.5239756107Getting Thirsty...Smashing!You broke it, you pay for it!Flipping the tableKeep Calm, Make TeaRAGE QUITJust a spoonful of sugar... 11 8.93
View unlocking history of this single game only
Anomaly 2 -1 0 0.00 0.7470077872First BloodTwo In OneDoomsday Weapon SpecialistGold StandardLittle CollectorArmor of SteelVR Is Overrated 65 115.66
View unlocking history of this single game only
Anomaly Korea -1 0 0.00 1.0498945713ThreatCollectorTop GearWar MongerPocket changeMy Private ArsenalFire away! 35 58.38
View unlocking history of this single game only
Anoxemia -1 0 0.00 0.96656388041st deathI must complete the missionTreasures!Mark?Oxygen10th deathI’ve got the power! 23 42.66
View unlocking history of this single game only
Aqua Kitty - Milk Mine Defender 1.4345716238Super Dodger BreakerEspresso Piccolo - NormalCraboid ObliteratorMouthfish HunterSuper Paleofish WreckerPuffaboom PopperAngelfishy Smasher 12 12.66 1.2084439993Irresponsible GuardianEspresso Piccolo - EasySuper Chain MasterSuper Shot SpreaderOne DirectionFurry NavigatorEspresso Medio - Easy 24 45.79
View unlocking history of this single game only
Armello 1.5979826450Baned-AidAlphaForce of NatureThe Fresh PrinceBully MammothSiege SpecialistDark Temptation 30 30.40 0.9095966816DiplomatDown the Rabbit HoleArmed & DangerousMistrialLoose ChangeThunder DomeBlackheart 20 29.76
View unlocking history of this single game only
Assault Android Cactus 1.3248448372Well ReadUntouchableAndroids AssembleEverything's CactusTo Cross The VoidPerfectionCollateral Damage 17 15.70 0.8861149549Chain ReactionWe Have To Go DeeperNothing But NetArt ConnoisseurMaximum OverdriveScrambled EggsI Am Become Death 12 19.88
View unlocking history of this single game only
Atlas Reactor -1 0 0.00 1.6475085020Massive AttackEye of the StormLevel 50Shield to the FaceCalculatedThe Power of FriendshipMassive Attack - II 121 268.87
View unlocking history of this single game only
AX:EL -1 0 0.00 1.0988221169BuilderFireBallBird HunterSpy HunterNo MercyACEPrototype Tester 22 34.48
View unlocking history of this single game only
Azure Striker Gunvolt 1.0483872890My Songs Will Be Your WingsOne With the LightningHasta La VistaBig Bad Electro Middle SchoolerTogether With JouleSumeragi RunIt's My Hobby!! 7 4.87 1.3936209679Mantis, Move Out!Tanks Aren't Supposed to Jump!!Master of the 7 DragonsOversurge! Azure Striker!The Muse's VoiceWaaay Too Slow!It's My Secret Love Technique!! 18 28.59
View unlocking history of this single game only
Back to Bed 1.2603136301No Time to Explain!Groundhog NightUnderstanding the Basics 3 3.07 0.9763456583The Button is Stuck!Deeper Into the DreamPatience is a VirtueGrown AttachedIf at First You Don't SucceedCheckmateNow You are Thinking With… 17 21.33
View unlocking history of this single game only
Bad Hotel 1.1662601233CulledSurf and TurfTenementClear SkiesOn Time, On Budget! 5 4.45 1.0391774178Thrifty BuilderTrigger HappySkyscraperToothlessCity SlickerMaster of the UniverseTop Trump 8 10.34
View unlocking history of this single game only
BARRIER X -1 0 0.00 0.9429682493Let's start the journeyHmm, that was easy!Let the Hunt Begin!One More TimeGrand ExterminatorUnstoppableYOU ARE A MONSTER! 7 9.72
View unlocking history of this single game only
BATTLECREW Space Pirates -1 0 0.00 1.2313536406Welcome to TortugaAway boarders!!!First victoryBloody pirateBuccaneer of the dayTreasure fleetPirate on fire 20 42.99
View unlocking history of this single game only
Battleplan: American Civil War -1 0 0.00 1.4779832363Engineer: built a bridgeBridge Burner: destroyed a bridgeTaken: held any battlefield objective that you didn't start the battle withStudent of War: watched all TutorialsUnion Militia Victory Pittsburg LandingUnion Militia Victory First Bull RunHeadhunter: killed an enemy general 95 211.91
View unlocking history of this single game only
Bear With Me -1 0 0.00 0.9738123417Arts And Crafts!I'm Into Heavier Stuff!Product Placement!Laughing Stock!Around The World!Fear Of The Dark!The Dynamic Duo! 75 109.16
View unlocking history of this single game only
Beatbuddy: Tale of the Guardians -1 0 0.00 0.9723367691Beatbuddy SwingSnare JumperLove SwingIn the RhythmMad on HealthLost In YesterdayDash Maniac 15 24.91
View unlocking history of this single game only
Between Me and The Night -1 0 0.00 1.0150560141Why was it so dark?It’s snowing…It seems like only yesterday.I’m getting the hang of this.I can’t leave this here.Forever young.Welcome to the real world. 18 28.23
View unlocking history of this single game only
Binary Domain -1 0 0.00 0.6614003181Seek and DestroyWeapon CrafterWater SliderSpendthriftHIT AND RUNA Friend IndeedJackpot 49 68.07
View unlocking history of this single game only
Bionic Dues -1 0 0.00 1.0758318901A Rogue With No Points In Subtlety (Casual)A Rogue With No Points In Subtlety (Easy)A Rogue With No Points In Subtlety (Medium)A Promising BeginningSimple Battery (Casual)Simple Battery (Easy)Take That, Metal Man! 220 510.89
View unlocking history of this single game only
Blade Ballet 1.1988571882Impeccably OrdinarySituation Under ControlThat Evil ThingSniped! 4 4.29 0.89470362669 LivesConscientious ObjectorCyclone of Death!The Baddest De-CorkerBreacherPeerless LancerFerocious Feline 14 22.07
View unlocking history of this single game only
Blaite -1 0 0.00 0.9990330935Welcome!You already learned to play!You thought it was easy, right?Rematch!Team workChapter 1 6 7.29
View unlocking history of this single game only
Blitz Breaker 1.4947685003SILVER STARRETRY AWARD 2 2.87 1.5721882582SCORE CENTRICFUNDING AWARDGOLD STARVICTORYSCORE CENATENACITYGREEN STAR? 11 20.17
View unlocking history of this single game only
Block N Load 0.8554701209The Token CollectorPractice Makes PerfectSweet Taste of VictoryDown the Rabbit HoleOne Block at a Time 5 2.72 0.4421499968And so it begins…Crossed the LineHenshin!The Bricks Must Flow!The Grey PilgrimBuddy Up!A challenger enters 61 92.82
View unlocking history of this single game only
Block'hood -1 0 0.00 0.5193719268Chapter 1Chapter 2People 1JourneymanPeople 2Basic TutorialsIntermediate Tutorials 39 52.81
View unlocking history of this single game only
Blockstorm -1 0 0.00 0.6847009659Stroke of luckJust One ChanceCarpe DiemPull!ScapegoatTrampolineRage Quit! 131 283.69
View unlocking history of this single game only
Bloop Reloaded -1 0 0.00 1.4903904200Happy DayForce PullerMeteor CollectorThe ThinkerMap CreatorMixerHalfway there 11 19.36
View unlocking history of this single game only
BLUE REVOLVER 0.6674784422HASKEL Clear! [Hyper]Mission CLEAR!Supplies DeliveredHASKEL Clear! [Normal]DELPHI Clear! [Hyper]The BeginningEXTEND! 11 4.35 0.5875666738YASUMI Clear! [Normal]The AscentThe PerfectionistLUNA Clear! [Normal]Fully StockedNORMAL Clear!YASUMI Clear! [Hyper] 29 41.53
View unlocking history of this single game only
BoneBone: Rise of the Deathlord -1 0 0.00 1.0783480406New HandsBull's-EyeYou Shall Not Pass!Our HopeThe Dead Should Stay Dead!Little ArmyPower of Crossbow 18 26.02
View unlocking history of this single game only
Bot Vice 1.0976353884GungirlClean ShootingA-GentFearless Thunder 4 3.84 1.2121542692Shot-ChopBlastingBoulder DodgerThe RipperRevengerRocket WizardDancing in the Beamlight 29 42.18
View unlocking history of this single game only
The Bridge -1 0 0.00 0.4745062590ThinkerAcademicScholarAftermath-InverterRunnerChallengerBridgewalker 20 21.70
View unlocking history of this single game only
Broken Age -1 0 0.00 0.8289457560Please Don't Tell AnyoneWhoops!She's Doomed Us AllThere Is HopeQuestion Your EldersMother and Child Reunion"My Lightness!" 45 52.22
View unlocking history of this single game only
Brütal Legend -1 0 0.00 0.4403254390Got a Car and a DateStart a RevolutionThick as a Baby's ArmOne Hit WonderHair RemoverFrench Kiss InstructorChicks n' Booze n' Stuff 59 89.14
View unlocking history of this single game only
The Bureau: XCOM Declassified -1 0 0.00 0.6341691017All That RemainsDead HeadBringing down GoliathThe Last Suit You'll Ever WearIs He Old Enough to Drive?So Just Let Me Introduce MyselfAway Team 34 39.09
View unlocking history of this single game only
Burgers -1 0 0.00 1.0766181946Body PilesCar WreckerBetter Keep Your Head DownA cure for all ThisAssault Rifle 5 5.84
View unlocking history of this single game only
Card Hunter 0.4030082226Adventurer 1 0.40 0.8480734229CollectorAllySlayer of MelvelousRookieDefender of WoodhomeBounty HunterFairy Finder 49 102.13
View unlocking history of this single game only
Castle Crashers 0.3279755712Melee Is Best 1 0.33 0.5622256398Maximum FirepowerDeer TrainerTreasure HunterTraditionalMedic!The TraitorKay Eye Ess Ess 11 11.84
View unlocking history of this single game only
Cataegis : The White Wind -1 0 0.00 1.4126371145More to ComeMissile DividerFried FlierSplit SpearsTowards the ZigguratBring ItI'll have that turret 41 86.85
View unlocking history of this single game only
Cave Story+ 1.3435471058Happy Birthday Pixel!I'm Juggernaut...CowardPanty RaiderShtuff HappensEvil to the CoreMuscle, MD. 37 26.17 1.0415477753Ladies' ManTow Me A RopeLittle ManWhat A Fun Guy!So easy, so so easy!I've Got Your BackDucking Awesome 39 67.76
View unlocking history of this single game only
Caveblazers 0.9922308326Super Powered!The Harder They FallBrute ForceExecutionerCaveblazin' 5 3.86 1.1529992819BestiesQuafferArena ChampionGiant SlayerHabitual CaveblazerComplete!Historian 16 30.91
View unlocking history of this single game only
Cavern Kings -1 0 0.00 50Trophy KingTreasure KingCavern KingFriendly KingWeapon KingHeart of BelialAces 36-36 0.00
View unlocking history of this single game only
Celeste 0.83399629591UP!Center of the EarthGolden FeatherQuiet and FallingGood KarmaHeart of the MountainReal Gamer 23 10.90 0.6443518400Heavy and FrailMirror MagicPink SunriseNo More RunningSay GoodbyeImpress Your FriendsThanks For Playing 9 7.88
View unlocking history of this single game only
Chasm 1.7434326410PrizefighterBone WormWendigoWarrior 4 4.83 1.3008203506Monster SlayerTitanKing TrellBig SpenderShamanGladiatorSuperhero 16 25.01
View unlocking history of this single game only
Chivalry: Medieval Warfare -1 0 0.00 0.5267734528Reach level 5Vultures ChefTwo handed weapon UnlockedBastard weapon UnlockedReach level 10One handed sharp UnlockedPolearm Unlocked 49 58.32
View unlocking history of this single game only
Chompy Chomp Chomp -1 0 0.00 0.9805493951Yellow ChainPurple ChainChompyAlternating Bonus 2Alternating Bonus 1ChomperDeathwish 27 35.83
View unlocking history of this single game only
Clicker Heroes 0.4362171888Bounty: The Green OneNeverendingMass MurdererZone OwnerBoss ExterminatorTerminatorMentor 31 7.22 0.4008221030Broken MouseAgain and AgainBounty: Woodchip, the RodentBounty: Queen of BloopsLevelupperBounty: Doppler, the RobotFinger Amputee 80 72.15
View unlocking history of this single game only
Clustertruck -1 0 0.00 0.2678953409The RudeDeck the trucks!King Of The ForestBelow FreezingRave OnOld SchoolMaster 19 12.92
View unlocking history of this single game only
Company of Heroes 2 -1 0 0.00 0.6288192868M.01 - German EngineeringCampaign ConscriptStalingrad Rail Station - ConscriptSenior PrivateComp-Stomp ConscriptM.01 - Compassion in WarStalingrad Rail Station - Captain 378 624.08
View unlocking history of this single game only
Cortex Command -1 0 0.00 0.6646630764Hello There!So That's What It's AboutTechnical WinAren't You CleverThese Guys Are Awesome!Pyrrhic VictoryOne Star General 11 16.15
View unlocking history of this single game only
CPU Invaders -1 0 0.00 0.94691979891234100056 13 15.27
View unlocking history of this single game only
Crab Dub -1 0 0.00 1.0559785366CrabMagic pillJellyfishLittle duckSpaceKittenSpace donkey 18 23.26
View unlocking history of this single game only
Crawl 1.5162401199A Death FeudThe GamekeeperVermin's ScourgeThe Acclaimed CollectorThe Lonely MiserThe Novice ScholarA Taste For Revenge 7 9.11 1.7662642002The Wealthy MerchantA Vengeance InsatiableBrain HaemorrhageInfinite HorrorUnceasing LethargyThe Gilded BaronThe Beastmaster 38 90.45
View unlocking history of this single game only
Crazy Taxi -1 0 0.00 1.1392889023Arcade C-licenseOriginal C-licenseArcade B-licenseArcade A-licenseArcade S-licenseOriginal B-licenseOriginal A-license 12 18.67
View unlocking history of this single game only
Crossing Souls 1.1197506189A popular dudeMaster SplinterHunted ChameleonFor the greater good...Tell us another story, GrandmaGo to hellRusty heart 21 17.58 0.8735693097Evil babyRoy, I'm already insideWhat were you staring at?!An exemplary studentUnbounded interrogationInscriptiana JonesLast words 11 13.85
View unlocking history of this single game only
Crusader Kings II -1 0 0.00 0.9396156073The Marriage GameFull HouseAlways Bet On DukeUntil Death Do Us PartRoyal BloodIt's Good to be the KingExalted Among Men 32 51.24
View unlocking history of this single game only
Crypt of the NecroDancer 0.7820173502In The Zone (3)In The Zone (2)In The Zone 3 1.74 0.7432069778MerchanticideHeartthrobIn The Zone (4)Friendly FireSo Hardcore!A Beatless BeatdownLute that Loot 25 43.68
View unlocking history of this single game only
CRYPTARK 1.6027458906Assimilated OutsiderResidual FungusReclamation GrinderCybernetic Prosthetic 4 5.47 1.0386461020Processed OreAlien ArtworkExploratory ProbeAncient Support StrutAssimilated OutsiderStar Map FragmentFossilized Skeletal Remains 23 34.33
View unlocking history of this single game only
Cubetractor -1 0 0.00 1.7346231937Placer of the CubesCritter HunterCubeXaminatorSteamrollerA touch of CubeManshipBipolar CubeXpeditionAs if that weren't enough! 13 27.65
View unlocking history of this single game only
Cuisine Royale -1 0 0.00 0.8997841477Ready to fight!First bloodThe dinner is servedThe invisible manUnstoppableGunslingerThe king 13 30.04
View unlocking history of this single game only
Curses 'N Chaos 2.4020547867Bounty HunterSilly Movie ReferenceFallen StarGrave SituationWasteland WarriorCastle CrashedFat of the Land 19 43.27 2.5269935131Elite FighterAgent of Chaos 2 5.05
View unlocking history of this single game only
Dandara: Trials of Fear Edition 2.0092744827Seasoned ExplorerIn the mercy of SaltStories of FreedomSalt's RealizationThe Secret of the DreamsThe Intention SideWide open face, hidden heart 11 17.69 1.9386934042In the favor of SaltIn the command of SaltThe Salt LeaperThe Treasure HunterThe CompletionistNo DistractionsNo Hand-holding 12 28.67
View unlocking history of this single game only
DarkEnd -1 0 0.00 1.8320003748Into DarknessCorrupt No More!The Princess is in another castleHeigh-Ho!BeginnerItJe suis monte! 26 56.01
View unlocking history of this single game only
Darkest Dungeon® 1.2370289564Two years of this...In Sheep's ClothingGnawing hunger sets in...Like lambs to the slaughter...Valiant sacrifice...That'll do, pig...Murder of Crows 50 31.50 0.8410847187What is already Dead Cannot DieThe abbey my Ancestor once knew...Restored to its former glory...Lone survivorBlocked from life...Four on the FloorWe return to the worms of the earth... 19 27.54
View unlocking history of this single game only
Darkest Dungeon®: The Color Of Madness 0.7554262280Time Is A Flat CircleBlue Skies AheadTears Lost In The DustThe Blinders Are LiftedA Merciful ActA Taste Of Madness 6 2.94 0.3431410491There Are No WordsBeyond The InfiniteA Poor HarvestThis Is NothingA Hollow ReckoningLining the Jeweller's PocketsPlowshares To Swords 14 13.83
View unlocking history of this single game only
Darkest Dungeon®: The Crimson Court 0.7146907449Happy TogetherJailbreakWhat Strange BedfellowsAn Unexpected PartyFrom Rubble to RabbleSymptomsThe Flesh is Willing 7 3.74 0.7616802454Les Jeux Sont FaitsZealous AccusationJust the ChequeExpiredThe Red HookHer Last DanceShadows Blur Together 8 8.79
View unlocking history of this single game only
The Darkness II -1 0 0.00 0.4744470119Jackie's Got TalentCheque Please!I'm Just Getting StartedMmmm Essence!Escape the BrotherhoodStorm the MansionOne Flew Over... 50 50.68
View unlocking history of this single game only
Dead Cells 0.6730167866Incy Wincy…Faster than light!Fortune and glory, kid. Fortune and Glory...Going down!Is there something in your eye?The dead center of the island...La Brute 29 10.77 0.4872751534Blade MasterPlease leave your shoes at the entrance.See, that wasn't so hard now, was it?Bend the knee? I think not…Surgical extractionThe last rampart falls...Even the rats avoid the place... 26 32.12
View unlocking history of this single game only
Deep Dungeons of Doom 1.5693012476OccultistArcadeBeast SlayerDead by DawnMonopolyInvestigatorUndead Slayer 18 18.43 1.2017809153Barely a ScratchUndyingBeowulfMerciful BlowIt's not Safe hereHeroMaking Savings 28 49.11
View unlocking history of this single game only
Deep Sky Derelicts -1 0 0.00 0.9157209992Flawless VictoryRust in PeaceNo Time WastedErrand BoyFirst of ManyFully ProficientNo Fear of Zombies 68 128.87
View unlocking history of this single game only
Defend The Highlands -1 0 0.00 1.4869250059Warrior of the HighlandsBagpipe PlayerMasteryThane of the HighlandsFearsome LeaderMashed PotatoHat Trick 40 82.02
View unlocking history of this single game only
The Descendant -1 0 0.00 1.0414711237At World’s EndI've Got a Bad Feeling About ThisBig Bada Boom!Master of NoneAt Episode’s EndSimmer DownHostile Work Environment 10 12.99
View unlocking history of this single game only
Destiny Warriors -1 0 0.00 1.4348210096Ring-a-Ding-DongWanna meet that dadDefeated IkiboBrother FightPart TwoTil Next Time 6 9.48
View unlocking history of this single game only
DiRT 3 Complete Edition -1 0 0.00 0.5126115680Into the DiRTReputation BoostToday's Forecast is...Victory!Rising TalentDriving SchoolKick Off the Training Wheels!Watch the Paintwork! 60 89.10
View unlocking history of this single game only
DISTRAINT: Deluxe Edition -1 0 0.00 0.8715363145The First DistraintCoffee, Please!The Fire MakerThe Second DistraintWhere Is Your Dignity?The ElectricianSniff This! 16 17.09
View unlocking history of this single game only
Divide by Sheep 0.8005511165Om nom nomWill it float? 2 1.53 0.9384369850SplatHello WorldWho put these lasers here?It's a trap!Stay frostyIce Ice BabyWill it burn? 17 23.06
View unlocking history of this single game only
Downwell 1.3875184059So Many GhostsSo Many FrogsSugoi ComboBye WellGround AllergySaving UpBye Stuff 16 12.96 1.4077218771FrugalitySo Many SquidsSo Much StuffWell Master 4 6.06
View unlocking history of this single game only
Duelyst -1 0 0.00 0.7276666760Journeyman QuestorHelping HandEntering The GauntletBest of FriendsEpic QuestorWorld ExplorerThe Art of War 10 10.49
View unlocking history of this single game only
Dungelot : Shattered Lands 0.9211221337Skeleton Archer SlayerMonster SlayerFamous Bounty HunterHell of a DietWealthFrom Dusk till DawnMage 22 14.47 0.7776323557Undead BeefNovice ArmorerGathererGoblin SlayerWizardZombie SlayerYou no take candle! 35 39.51
View unlocking history of this single game only
Dungeon Defenders II -1 0 0.00 0.3871394992Defender InitiateForgot to HealDefense ProdigyVeteran DefenderTriggered My Trap CartBomb SquadShoots Da Fire 18 20.44
View unlocking history of this single game only
Dungeon of the Endless™ - Crystal Edition 2.0745425224Champions' LeagueEndless DayGuns 'n GloryScience Fair WinnerGraduated Med SchoolDust HoarderMedpack Addict 18 19.50 1.0355252028Real Heroes Don't PauseThe Other Great EscapeRocket ScientistDexterousBookwormMembers OnlySoiled with glue 11 19.66
View unlocking history of this single game only
Dungeon Souls 1.1157618761I Am Now Ready! 1 1.12 0.9461630583Indiana Jones'dPuny Skeleton KingKeep 'Em Coming!The Whole Crew's Here!Good ArchitectureFreedomGold Swimming 9 12.38
View unlocking history of this single game only
Dungeons 2 -1 0 0.00 0.8757779598Little SnotUgh, Daylight!The King is Dead, Long Live the Evil!Stay and fight, you coward!Cleaned out the Crystal ChamberMine SuperintendentThe Last Unicorn 25 34.33
View unlocking history of this single game only
Dust: An Elysian Tail 0.9941484928Savior of FalanaOne Last WishThat's More Like ItOpposite of FailAn Impressive DisplaySilence Those GunsRenegade 25 16.42 0.8775410056Blue BomberBad TherapistBaker's DozenAbove and Beyond the CallThe Stuff of Legends 5 5.39
View unlocking history of this single game only
Dustforce -1 0 0.00 2.4010317326Double S+ 1 2.40
View unlocking history of this single game only
Eador. Masters of the Broken World -1 0 0.00 1.0916279554The Obnoxious CompanionThe Glorious OpeningThus Began the EmpireA Career in the MakingReanimationThe Royal GuardPathways to Mastery 56 96.47
View unlocking history of this single game only
Endorlight -1 0 0.00 50Developer achievement 1-1 0.00
View unlocking history of this single game only
Enemy Mind -1 0 0.00 1.1083092690Beep Beep!EnsignLeap of FaithEmpathic ConditioningLieutenantReflectionsVeteran 34 71.37
View unlocking history of this single game only
Energy Balance -1 0 0.00 1.1288509369Begin0,33333330,6666666Almost thereMeowie fixedHardcore halfFull hardcore 9 15.81
View unlocking history of this single game only
Energy Cycle -1 0 0.00 1.1742645502The beginning of the cycle25% CycleFirst level created!50% Cycle75% CycleCycle complete!Layer #10 9 14.12
View unlocking history of this single game only
Enter the Gungeon 1.3058654070RiderGun GameTrickshotGreat HallBeast MasterCartographer's AssistantBeep 33 27.43 0.7991018891Biggest WalletReverence for the DeadJammedExorcistTime ParadoxGoing DownestForger 21 24.39
View unlocking history of this single game only
Epistory - Typing Chronicles 0.8885852695MarathonStatic Shock1% Muse: Pride and PrejudiceMultitaskingDrowning Halls1% Muse: Foundation1% Muse: Frankenstein 21 14.39 0.8270730376The quick brown fox...1% Muse: For Whom the Bell TollsIce MausoleumCreation CityWinds of ChangeTypistSlayer 34 39.49
View unlocking history of this single game only
F1 2015 -1 0 0.00 1.3266282082Pole SitterMe, Myself and I1, 2, 3, PodiumOne AimOne with the CarOnline WinnerTotal Recall 45 78.46
View unlocking history of this single game only
Faeria -1 0 0.00 1.9417897463Welcome to Faeria!Mission completeSlayingTo the FaceBurnSkilled AdventurerSlaughter 59 164.29
View unlocking history of this single game only
FaeVerse Alchemy -1 0 0.00 1.0805879831Chaos AwakensAbyssal ConvictionChaos MoteChaos FaerieAbyssal KnightChaos NoviceAbyssal Monarch 15 23.38
View unlocking history of this single game only
Fallen Enchantress: Legendary Heroes -1 0 0.00 0.6542018652Built a CityMonster KillerRecruited an NPCDefeated an ArmyAdventurerExplorerExperienced 54 80.37
View unlocking history of this single game only
FAR: Lone Sails 0.7987573147The Sound of SilenceA piece of HomeMy Heart will go onThe answer to life, the universe and everythingHoarderGoodbye old FriendPimp my Ride 11 4.95 1.1224913597Fire in the Hole!I got 99 minutesIt’s over 9000! 3 3.75
View unlocking history of this single game only
Fidel Dungeon Rescue 1.3937466145Nobody dare touch my grandmaChew a MimicSecret LevelEat 4 PlantsFlashbackDying a lot is fine 6 7.15 1.2143757343Good Dog!CheckmateParty is OverDead dog CAN barkFidelNo ZappingWho you gonna call? 19 32.08
View unlocking history of this single game only
Figment 1.6652674675NostalgiaChecking the GearsBlademasterWaterboyLovecraftian ShenanigansOvercoming FearComing Back to the Surface 16 23.62 1.4592955112ExterminatorNoisy NeighborSeeking InspirationDistant MemoriesTime for TeaTurning on the LightNow it all Makes Sense! 7 11.48
View unlocking history of this single game only
The Final Station 0.5680193901Station A-45 1 0.57 0.6353662610Push BackSide EffectsCollateral DamagerThe L-abs BunkerYes You CanHome SafeCity of The Factories 22 33.05
View unlocking history of this single game only
Fire With Fire: Online Tower Attack and Defense 1.1512219906Fire Safety 1 1.15 2.3050367832Sweet Burn SpotfireSweet Burn Blue GiantSweet Burn Triple FissionSweet Burn NagaBlaster Fire ExtinguisherSeeker Fire ExtinguisherSweet Burn Fire Rain 30 84.66
View unlocking history of this single game only
The Flame in the Flood 2.1710541248Animal FriendThe KingdomThe Path UpPack RatHigh GroundI been everywhere, manSnake Charmer 10 15.28 1.5358262062ForagerInvincibleBy A ThreadField MedicCan Bearly Take ItSeamstressSeafarer 26 53.28
View unlocking history of this single game only
Flinthook 1.4859014750Liquified Von GuuBronze Infinite RunSpace CaptainPlucked GoldfeathersRoastedQuarter MasterTwitch 9 10.14 1.3027255535Silver BullseyeFast PluckerGolden BullseyeShipwreckerSilver GoldfeathersFall of GwarlockFingersnap 28 48.07
View unlocking history of this single game only
Forge of Gods (RPG) -1 0 0.00 0.7290204763New GodStart of the journeyAlter EgoWe're gonna be richRank UpCastle is my houseFirst Blood 58 87.14
View unlocking history of this single game only
Fork Parker's Holiday Profit Hike -1 0 0.00 0.6101641059Fork ParkerProfits Are DownBase CampFork ParkourHR ViolationVertical IntegrationThe real Fork Parker starts here. 17 23.85
View unlocking history of this single game only
Fortified -1 0 0.00 1.3485463858Ivy LeaguerGoose It!Big SpenderReporting For DutyIce to Meet YouBring Him Down!Circuit Breaker 23 42.36
View unlocking history of this single game only
GALAK-Z 1.7691910267My Shields Are Blown!Darkest Before DawnGolden WingsDon't Mind Me 4 4.72 1.4632132053Variable FighterThat Would Be StealingTreasure HunterMetamorphosisEye of the StormShields Are For Wimps!Thieving From Thieves 31 75.84
View unlocking history of this single game only
Gemini Rue -1 0 0.00 0.9173669815DiplomacyGeminisGive me a Hard CopyRue the DayStair masterGood SamaritanMemories 15 20.84
View unlocking history of this single game only
Giana Sisters: Twisted Dreams -1 0 0.00 0.4412851632Dream TwistRuby-Red PirouetteCitrine CannonballA Flurry of FeathersA Brush With DeathSoft LandingShell Shock 25 44.10
View unlocking history of this single game only
Gone Home -1 0 0.00 1.3744173050Gone HomeNesting InstinctMeow Meow MeowIntuitiveThis Old HouseLetters to KatieWet Bandit 10 15.59
View unlocking history of this single game only
GoNNER 1.7947509289The floor is lavaGet off my lawn!COMBO GODGLYPHSImpressive.Good job.Combo bomb 10 13.07 1.8022431135Smooth!HahahaWoah!Stare into the abyssUndeadI can take care of myself.lovelovelove 9 17.73
View unlocking history of this single game only
Graceful Explosion Machine 1.2913355827Scarlet Ep So LongHomeward BoundSnatch Defeat from the Jaws of VictoryCatacombyeeee!No Flipping ModeSnipe, Sniper, SnipestS+ is+ for S+upers+tar 20 19.48 1.1809962988∞ goodPerfect PlanetLet's do the time WARP+ againMaster of the Universe 4 5.60
View unlocking history of this single game only
Greyfox -1 0 0.00 1.1040613651A Dirty Job10. Tea BaggedPickpocketMabelThe NurseMr. BrownThe Kat Lady 16 19.62
View unlocking history of this single game only
Guacamelee! Gold Edition 1.5812478065Bone on boneCatch the Rainbow!They hit really hardGOOOOOOOAL!The Old-Fashioned WayTitle ContenderThe Devil wears Revenge! 58 54.99 1.5615382195World ChampionThat was Hard Mode? 2 3.23
View unlocking history of this single game only
Gun Monkeys -1 0 0.00 0.8422471881Prime MateMonkey FeverStill AliveCheeky MonkeyWinning Streak!CocktailFly, Monkey, Fly! 8 9.40
View unlocking history of this single game only
Gunpoint 0.5719508529Perfect GentlemanI'll Aim When I'm DeadGentlemanSo This Is Why People Don't Like MeDingGhost 6 2.58 0.3825240731Short CircuitCat BurglarOpen Door PolicyI May Be Some TimeRooke SympathiserCover UpBreaking And Entering 36 26.02
View unlocking history of this single game only
Guns of Icarus Alliance -1 0 0.00 0.9676697254Hands OnThe Grand TourLook AliveStop, Drop, and RollBroad Side of a BarnHow Stuff WorksBody Work 849 2270.04
View unlocking history of this single game only
Guns of Icarus Online -1 0 0.00 0.4289458096Hands OnThe Grand TourLook AliveBroad Side of a BarnHow Stuff WorksStop, Drop, and RollBody Work 849 2460.57
View unlocking history of this single game only
Hacknet -1 0 0.00 0.7373645306EntropyCSECMakeover!To the WirePointClickerYou better not have clicked for those...Quickdraw 11 12.22
View unlocking history of this single game only
HackyZack -1 0 0.00 1.5019650459World 1 SquashedWorld 2 CrushedSord BearerIsolationWorld 3 SqueezedWorld 4 TrampledDenial 27 60.64
View unlocking history of this single game only
Halcyon 6: Lightspeed Edition -1 0 0.00 0.8362360597Tier 1 ShipBlanket Fort BaronKnowledge is PowerBeam Us Up, EnsignOne Star ShipCity PlannerTwo Star Ship 71 128.40
View unlocking history of this single game only
Halcyon 6: Starbase Commander (CLASSIC) -1 0 0.00 0.7009848952Tier 1 ShipBlanket Fort BaronKnowledge is PowerBeam Us Up, EnsignOne Star ShipTwo Star ShipBandit Hunter 69 103.83
View unlocking history of this single game only
Hammerwatch 0.7457095385The QueenMass murder 2 1.24 0.5236994624AffluentThe Grisly CombinationThe KnightRichHarvestingThe LichThe Dragon 36 55.58
View unlocking history of this single game only
Heckabomb -1 0 0.00 1.3213399649ROCK ONVOGON CAPTAINABOUT TO ROCKSMALL HAULMINE ALL MINEROOKIE BADGEROCK STEADY 46 92.43
View unlocking history of this single game only
Hektor -1 0 0.00 1.7145966291Sorry I’m late, BossUnderdogThick SkinDown the Rabbit HoleDisobedientA.E.A.God Mode 16 33.62
View unlocking history of this single game only
Hell Yeah! 0.9526925683Good santa!Fashion victim!Pimp that wheel!Armed and dangerous! 4 3.32 1.0053640604Quick rabbitIsland's masterBug tracker!Weapon CollectorGroundhog day lover!Superior Completion Skillz!JACKPOT!! 8 10.83
View unlocking history of this single game only
Hello Neighbor -1 0 0.00 1.3517396450Hmmm BaconGet'em GeorgeUp Up!No More FearsTop Of The WorldI Had No Choice!Wrong Place To Bury 17 27.24
View unlocking history of this single game only
Her Story -1 0 0.00 0.4837740660It's a happy ending.A Traditional BalladHave you ever eaten fennel?Expressing My IndividualitySpilt CoffeeThe ReflectionDetective Sergeant 13 7.82
View unlocking history of this single game only
Hero Academy 1.1519502401Well EquippedBlowing Up in StyleBOOM! Headshot!Cry Some MoreStanding StillThe Best and the BrightestTake All Day Academy 14 11.55 0.9100728035Level the FieldStomp the YardVvvictory!Pocket MedicI'm HookedOld SchoolNice to Beat You 26 34.23
View unlocking history of this single game only
Hero Academy - Dwarves Pack 0.5712994337Shields Up! 1 0.57 0.5105671287Short But FeistyHero, Heal ThyselfClose EnoughMy BoomstickStrangeloveDwarven Hero 6 4.98
View unlocking history of this single game only
Hero Academy - Shaolin Team Pack 0.5952832699Sweep the Leg 1 0.60 0.4880399704Triple ThreatBad DiseaseWe Are OneMine, All MineI Like VanillaSo Many Victories 6 4.98
View unlocking history of this single game only
Hollow Knight 1.2104858160Happy CoupleFoolMaskedGrand PerformanceSolaceBlessedStrength 35 24.64 0.7420344949RivalryWitnessVoidMortalityAscensionDark RomancePurity 28 34.94
View unlocking history of this single game only
Homefront -1 0 0.00 0.5454992652ChroniclerWhy We FightFreedomFire SaleThe WallHeartlandOverwatch 47 63.25
View unlocking history of this single game only
Horizon Shift -1 0 0.00 1.2187179327That's a Good StartOne DownBoom!Big Boom!1UpHorizon HeroFlawless Victory 12 24.95
View unlocking history of this single game only
Humanity Asset -1 0 0.00 1.3661730289Training1MaxMission0BomberTraining2BigbossGunkeeper2MaxMission1 38 82.73
View unlocking history of this single game only
The Huntsman: Winter's Curse 1.3363661766Lost BrothersGeorge's Cloak 2 2.42 1.8230327368The SanctuaryMagic's WebA New MemberThe Mountain's SecretThe Enchantress' PowerYou've Got A BoatInner Battle 8 15.11
View unlocking history of this single game only
Hyper Light Drifter 1.4525442123Natural LeaderArmoryDiamonds Are ForeverThe Dash EternalStar AthleteMeditationNothing's Easy, Now is it? 10 10.36 1.0775272846BullyLine Em' UpLibrarianBoss Rush Level 1ContenderWalk-In ClosetShine Bright 13 21.90
View unlocking history of this single game only
Iconoclasts 0.6206440330Life ExperiencePitch BlackPearly GatesColoring AgentFeature CreepParrying Mechanic 6 2.79 0.9986338019PsychopompsMelodramaBeaucoup BootyMultitoolOne-Hit Wonder 5 5.62
View unlocking history of this single game only
Insanely Twisted Shadow Planet -1 0 0.00 0.9797847271Complete HomeworldComplete OrganicComplete OceanComplete IceComplete MechanicalComplete ElectricalComplete Game 17 31.29
View unlocking history of this single game only
INTERSHELTER -1 0 0.00 1.2871795893First blood69SurvivorPunisherHeadacheKillerEnergizer 12 21.95
View unlocking history of this single game only
Into the Breach 1.1271917820ChronophobiaTrick ShotHard VictoryUnbreakableEngineering DropoutDistant FriendsTrusted Equipment 42 28.53 0.7755017877There is No TryHold the LineGlittering C-BeamOverkillLightning WarMech SpecialistChange the Odds 13 13.18
View unlocking history of this single game only
Invisible, Inc. 1.8966642618Meta-HackingAnt SocietyMeat MachineTraining WheelsTarget ResolvedNearing Confidence ThresholdGhost Moves 9 8.91 1.3733869791Fully EquippedThe LimitInvisible Inc.Powerful ToastDaemon CodeRebuilding the FirmNever Look Back 14 28.03
View unlocking history of this single game only
Jack Lumber 1.6754853725All that GlittersQuintpicsSplinter SellMore like "Threebeard"Silver Bells... er SashesPerfected the peaksTurns green when wet. Or is that copper? 20 27.21 1.5832959414You're doing it wrongSyrup SycophantWe're going to need a bigger razorSap-o-holicDaddy WarlogsFinish your errands, Jack!Plaidtastic 7 12.05
View unlocking history of this single game only
Jet Set Radio 0.7800991535We got us a crewFeel the Beat 2 1.43 0.9925829172I Need a ParachutePublic MenaceLook BehindRemixes Suck!Unlock GaramFirst Coat AppliedSecond Coat Applied 28 54.05
View unlocking history of this single game only
Jettomero 0.7173042893Forest RangerLunar StandingStorm ChaserToo Hot to HandleFinding A Purpose 5 2.89 0.6545134187A History RevealedTo be or not to beRubble RescueFinally a HeroAssisted TakeoffComet HunterAccessory Master 10 8.60
View unlocking history of this single game only
Jotun: Valhalla Edition -1 0 0.00 1.0196727514Tame the WildsDefeat the DarknessConquer the ColdWeather the StormShun the Gods - JeraBrave the InfernoValhalla Awaits 36 69.77
View unlocking history of this single game only
Juicy Realm 0.8029332757No Sweet Tooth!Wild WestPear PunisherDog Don't BiteMini Mistake 5 2.85 0.8540858030Spider or Crab?First JuiceDeathly DesiresMedic!One-Punch GirlSerpent SlayerApple Annihilator 31 41.19
View unlocking history of this single game only
Just Shapes & Beats 0.5260238051Hits after HitsChillBeatboxPretty goooood!It's Over, for real, reallyIt's Over, for realIt's trying to say something 11 3.44 0.4657279253SkillsFreestyleLearning itBreakcoreLow FivesGreatest HitsMad Skills 15 11.18
View unlocking history of this single game only
Kathy Rain -1 0 0.00 1.1124989986ProcrastinatorMr. Bear, reporting for duty!Get on the KatmobileHotwheelsWow, they're hypnotic...We've met before, haven't we?Down the rabbit hole 20 24.30
View unlocking history of this single game only
Keep Talking and Nobody Explodes 0.7853450179All in ModerationTrust the ExpertExperience is the Best TeacherBomb Defusing 101Action Hero 5 2.69 0.9558916092MultitaskerChallenge AcceptedTo the Extreme!Seasoned TravellerBomb Squad 5 7.94
View unlocking history of this single game only
Killer is Dead -1 0 0.00 0.5513236523Kidnapper ExecutedToast to ForerunnerAlice in Dead LandSuck Like a LeechHave You Got Clean Hands?9 to 1 on GoliathHad a Bad Dream 48 66.82
View unlocking history of this single game only
Killing Floor -1 0 0.00 0.1864411831ExperimenticenticideIt's Not Easy Being GreasySocial OutburstExperimentimillicideStraight RushA Bloody Christmas CarolPhilanthropist 285-1 347.56
View unlocking history of this single game only
Killing Floor Mod: Defence Alliance 2 -1 0 0.00 2.8753445148Lucky damageSetup the defenceClot ChampionGorefast ChampionBloat ChampionAlliance 1 - 0 ZombiesYou're a teamplayer 30 89.62
View unlocking history of this single game only
King Arthur's Gold -1 0 0.00 1.1993751526Brave new worldWinnerYou can talk!Braver newer worldRoger the ShrubberJust a flesh woundWHAT... is your favourite colour? 64 142.84
View unlocking history of this single game only
King's Guard TD -1 0 0.00 1.1106623411Arrow TowersBloodMytinaWarriors DownLegacyDestructionDragon Killer 10 16.51
View unlocking history of this single game only
Kingdom: Classic 1.6434243917The Tenth Day We Fought BackOn the Third Day I Lit a FireOn the First Day I Built an ArmyBy Day Six I Was RichDay XXVDay XXDay XV 9 9.97 1.0115056038Day XXXDay XXXVDay XLDay XLVDay LBy the Seventh Day I Cleared an AcreOn the Second Day I Got a Gift 25 39.43
View unlocking history of this single game only
Kingdom: New Lands 0.8527105451By the Sixth Day I Was Rich.Birth of a ReignDay XVDay XDay V 5 3.42 0.7831380367Day XXOn the First Day I Built an Army.Day XXVBy the Seventh Day I Cleared an Acre.On the Second Day I Got a Gift.Day XXXOn The Tenth Day We Fought Back! 29 41.40
View unlocking history of this single game only
Knights of Pen and Paper +1 0.6709169745Say Hi to the Game Devs!Hit That VeinBlacksmith Level Up!Tough Battle!UnluckyLuckyLevel 5 8 4.43 0.7690507770Level 15Class: BarbarianClass: BardWhat a Waste!Class: HunterGrindstone MasterDungeon Cleared 34 38.03
View unlocking history of this single game only
Labyronia RPG -1 0 0.00 1.0488818884Welcome to the World!Unknown ExplorerNo LoveDragon SlayerGuardian of the ElementsMonster Mash 6 8.58
View unlocking history of this single game only
Labyronia RPG 2 -1 0 0.00 1.6116271019Windir!Cold as IceBorder CrossingMr. PopularCrumbled Cave FightThe Beginning of the End 6 10.25
View unlocking history of this single game only
Layers of Fear -1 0 0.00 0.7598307133It's covered up for a reasonIt rings a bellWandererScraps of loveThe artist's impressionInspired OCDArtist's struggle 18 22.33
View unlocking history of this single game only
Legend of Dungeon 1.2564662695Hot Foot 1 1.26 1.1080718040Bar BrawlPETAAlcoholismWeak BladderHero!Boss SlayerNot Afraid of the Dark 15 38.66
View unlocking history of this single game only
The Legend of Heroes: Trails of Cold Steel 0.6345921755Breakout PerformanceFollow-Up MasterEightfold ObliterationMaking the GradeA Midsummer's RevelsBeyond the RailwaysThe Verdant City 12 5.62 0.5412524343Flawless JewelLink MasterSigns and OmensProgressive ChaosPut to the TestAdvanced BeatonomicsHeart of a Lion 39 35.39
View unlocking history of this single game only
The Legend of Heroes: Trails of Cold Steel II 0.6911515594Double the TroubleMind if I Cut In?TacticianAboard the PantagruelStar PupilAshen ChroniclesPieces of Eight 10 4.53 0.4738385677Transcendent JewelInseparableThe Awakening LionsOne Good Burn Deserves AnotherForward, RelentlesslyForging the FutureSmells Like Team Spirit 41 33.58
View unlocking history of this single game only
Legend of Mysteria -1 0 0.00 1.4520802498Its A Break Out!Sneaky SneakyA Loyal AllyDjinni The Magic DragonA Portal To LabyroniaAll In A Days Work 6 9.40
View unlocking history of this single game only
Lethal League 1.0389320850Mass KO ProductionLethal RivalsDouble PlayBats In The DarkRifle Strike 5 3.10 0.5648330450Chrono WarpClutchRookie PlayerChrono Warp ClusterOld SchoolGrand SlamAce Player 18 26.78
View unlocking history of this single game only
LIMBO -1 0 0.00 0.4556360841Altitude is AttitudeWrong WayWhere Credit is DueAlone in the DarkBacktrackingUrban ExplorationGuided by Sparks 13 11.80
View unlocking history of this single game only
The Lion's Song 1.1552529335A joke among friendsAll the praiseWho are you?Who needs sleep?A love songA letter from GreteSilence 10 9.98 0.9756351113The first threeSuccess?My familyA symmetry withinMy name?For the musicNo time to talk 10 12.88
View unlocking history of this single game only
Loot Hero DX -1 0 0.00 0.7131063342Loot HeroKnightJust StartingSeriousMaster LooterOverpoweredGrinder 20 16.10
View unlocking history of this single game only
Loot Rascals 1.2415380478Start Of The CenturyHow Did You Manage To Get Inside My Head?Better To Be Busy Than Bored 3 3.37 1.5795160532Funny TimesI'll Never Be The SameWatch Your StepEverything's OddI'm Waiting For YouI Killed The NeighboursRock And Roll Invoice 19 48.57
View unlocking history of this single game only
Lovely Planet -1 0 0.00 0.9295520782True SamuraiHarakiriAce CityHungry SamuraiGravesAce VillagePearl Dagger 14 21.90
View unlocking history of this single game only
Lovers in a Dangerous Spacetime 1.1989040375Belt It OutCouples Dance LessonsDressed to the NinesSpace-man's Best FriendClearing the AirWave GoodbyeBear-Knuckle Boxing 11 9.73 1.1591947079CootiesRocket ScienceLove Has PrevailedWarm EmbraceOverprotectiveExposedMissile Kiss 17 30.41
View unlocking history of this single game only
Lucius -1 0 0.00 0.4761186540First bloodDouble murderThere is no answerGetting the hang of itWe got ourselves a readerSerial killerAre You There God? It's Me, Lucius 58 55.78
View unlocking history of this single game only
LUFTRAUSERS 0.8463297486DONT MESS WITH THE RAUSERWHAT DOES SFMT STAND FOR?EXPERT RAUSERYOU WERE RAISEDSERIOUSLY, DONT MESS WITH THE RAUSERBIG SCIENCEUNDERWATER SUPERIORITY 10 6.12 1.6384308338SEEN IT ALLMASTER RAUSER 2 3.37
View unlocking history of this single game only
LUMINES REMASTERED 0.9847016931SprinterWorld in Slowmo300sec Challenge180sec ChallengeGalaxy WarsCombo Performer60sec Challenge 13 6.84 0.7264236808Agent TraineeDJ PlayerLights!Veteran AgentCharismatic DJFull ThrottleMission Accomplisher 17 19.97
View unlocking history of this single game only
Magicka -1 0 0.00 0.1403805315State AlchemistBasic ElementCooking by the bookAn eye for an eyeNo more trollingLet off some steamHoudini 52 38.80
View unlocking history of this single game only
Megabyte Punch -1 0 0.00 1.0455402136Bouldar down!100 Enemies downGeneral defeat!No more Grand Khotep...500 Enemies downSubprogrammed!I believe I can jump 30 57.82
View unlocking history of this single game only
Melissa K. and the Heart of Gold Collector's Edition -1 0 0.00 1.2913606167Been there, done that, got the T-RexInventory KingMay I Hint You?Gecko Says NoI Gotta Pea!Cruise ControlFearless 26 42.61
View unlocking history of this single game only
Mercenary Kings 1.0338640213Untouchable 1 1.03 0.8429988623ExecutionerDenied!HoarderBaron BashingFavoritePoacherIs That A Knife? 25 45.00
View unlocking history of this single game only
Merchants of Kaidan -1 0 0.00 1.6888476610Double moneyReal moneyLuckyJinxGadgeteerJewellerMonster Slayer 22 45.63
View unlocking history of this single game only
METAL SLUG DEFENSE 1.0517104864Area 2: Free "TARMICLE ROVING Ⅲ"!Area 1: Free "MARCHRIUS DENNIS ROSSI"!Area 2: "EAST ASIA" conqueredArea 1: "SOUTHEAST ASIA" conquered 4 3.57 0.9607589841Area 3: "AFRICA" conqueredArea 4: "CENTRAL ASIA" conqueredArea 5: "DR MOUREAU'S ISLAND" conqueredArea 6: "OCEANIA" conqueredArea 3: Free "FIOLINA GERMI"!Area 7: "NORTH AMERICA SOUTH" conqueredArea 4: Free "ERI KASAMOTO"! 60 76.36
View unlocking history of this single game only
Mighty Gunvolt 1.1259461641A Peaceful ApproachStockpilerShot to the HeartBlue ButterflyMaster of LightningOld-School CoolSuper Combo 8 7.28 1.0506951809Master of LoveMaster of MightPerfectionUnscathed Hero 4 4.62
View unlocking history of this single game only
Millennium - A New Hope -1 0 0.00 1.0741244555CuriosityGettin' On With the JobEverybody Has To StartDiscovering MystFairy WhisperThe First StepThe Examiner 52 95.06
View unlocking history of this single game only
Mind Spheres -1 0 0.00 1.04707610615 Puzzles!Released Energy.15 Puzzles!The Mind Gears25 Puzzles!Taste of Space35 Puzzles! 11 12.77
View unlocking history of this single game only
Mini Metro 1.0671232939Thames TunnelHopركابBilhete ÚnicoOPUSПодорожникDay trip 14 9.44 1.0396654606ClipperT-moneyCity of LinesEarl Grey交通一卡通SmarTripHook Turn 35 57.06
View unlocking history of this single game only
Minion Masters -1 0 0.00 1.0272318125Ranked WinnerApprentice CollectionThe Stone LeagueChallenge accepted!Ranked ConquerorSupreme!The Bronze League 38 53.09
View unlocking history of this single game only
Minit 1.0203105211BEST FRIENDDOG WASHERWORLD TRAVELERMINITSAFETY INSPECTORGHOST HUNTERCONNOISSEUR 17 13.87 1.0522502661PUNCTUALMARINE BIOLOGISTARCHEOLOGISTCOLLECTORTREASURE HOARDERFULL AIDERHI MY NAME IS MARY 10 12.62
View unlocking history of this single game only
MOBIUS FINAL FANTASY 0.6916855574Welcome to the MOBIUS FINAL FANTASY!! 1 0.69 0.8089309931Chapter One Cleared!Chapter Two Cleared!Chapter Three, Part One Clear!Chapter One Complete!Chapter Three, Part Two Clear!Chapter Four, Prologue Clear!Exploration One Clear! 34 45.31
View unlocking history of this single game only
Momodora: Reverie Under the Moonlight 1.5540406704PacifistImperishableBug CollectorExplorerHealthy!FaithfulP-pleasegiveittome! 8 9.68 1.6231216192Don't even try this. 1 1.62
View unlocking history of this single game only
Monaco 1.2932490110Technician 1 1.29 0.5639659762MassacreDem BonesWhackedSlipperySilent WithdrawalI Work AloneIdentified 12 19.10
View unlocking history of this single game only
Monolith 1.1262396574Tag ChampionThorough ExplorerMaster of the UnseenForbiddenAccursed OneAnnoyingEnd Layer 11 5.80 0.9365755916Ego Sum AeternaeSpeed RunnerTreasure TroveToo RefinedThose You Could SaveFreedomIntense 31 49.39
View unlocking history of this single game only
Moon Hunters 1.5093219280LoremasterAncestral InsightAncestral CourageAncestral GraceA New AgeAncestral StrengthBetrayal 13 13.72 0.9810076356Intrepid ExplorerDancerAncestral ArtistryChilledPazuza the Wind SpiritElopementAncestral Song 34 56.50
View unlocking history of this single game only
Moonlighter 1.6198159456Balanced WarriorGolem ApasionateSlime Protection ServiceScribeDecorative MindArcheologistRage against the Golems 34 33.52 1.0353959799Special PlaceGotta go fast!Rage against the ForestForest ApasionateHeavy WarriorDistant WarriorBerserk Warrior 33 63.26
View unlocking history of this single game only
Morphopolis -1 0 0.00 0.6967757940Seed SwapAphidoideaStigma TubesGlow WormsGrylloideaBettle PairingApoidea 13 10.50
View unlocking history of this single game only
Moto Racer 4 -1 0 0.00 0.9803819656RookieMom! Look at me!Attack of the plumberWhiplashTo infinity and beyondOléStart with Style 50 98.47
View unlocking history of this single game only
Mr Shifty -1 0 0.00 0.9421263933Yippee ki yaySurprise!Traitor1000 fistsBody Count RecordCapturedCatch! 14 19.35
View unlocking history of this single game only
The Mummy Demastered 0.6531325579Defy Human AbilityMonster BashThe Ultimate EvilHunt MonstersSeker SeekerThrough the HeartHeavy Duty 29 12.75 0.5528699160Eradicate EvilProdigium ProtectionCrush the DarknessThat Was IntenseStand your GroundWorld of Gods and MonstersUndead Agent 8 5.92
View unlocking history of this single game only
Nebula Online -1 0 0.00 1.9263648987Работоспособность двигателейNebula’s minerTechsmithConstructorPirate’s destroyerLlerey’s destroyerThrough asteroids and fragments 27 76.60
View unlocking history of this single game only
Necropolis 0.3691526055LibrarianPower SlayerAdventurous EaterCraftspersonWelcome to the Necropolis 5 1.32 0.3114343882Suit UpIntrepid AdventurerMisadventurerTrue AdventurerSneaky, SneakyEpic MiserMaster Librarian 8 8.78
View unlocking history of this single game only
Neon Chrome -1 0 0.00 0.8764888048SpiderbotHard WorkCentipedeHovertankOverseerGritExplosive 14 21.45
View unlocking history of this single game only
NEXT JUMP: Shmup Tactics -1 0 0.00 1.6148407459RookieYou know the sayingWasn't me at the bar!Another one bites the space dustFireworksI'm not cheatingIs it New Year already? 51 104.62
View unlocking history of this single game only
NiGHTS into Dreams... 1.4555573463the POSSIBILITYthe AFFECTIONthe IDEAL 3 4.01 1.3869482279Hello Mepianthe CONSCIOUSNESSthe CONFUSIONthe REVIVALMystic Garagethe GROWTHMerry Christmas! 10 17.63
View unlocking history of this single game only
Ninja Senki DX -1 0 0.00 1.5188738108Kick Down the Door!Flawless RevengeTanuki SoupSure You Can!Path to RevengeYokai BusterA Complete Ninja 26 45.50
View unlocking history of this single game only
Nova-111 2.3516094685Laser Master 3000To the PointSpeed RacerEnemy Infighting 4 7.30 1.6162102222Bomb DiggityWall GrinderBrojectileImmortal TechniqueStop, Hammer Time!Science, Yo! 6 14.51
View unlocking history of this single game only
Nuclear Throne 0.9863847494MMMMMMHMMM!Horror UnlockedGood FindSteroids UnlockedY.V. UnlockedHunter KillerSincere Apologies. 13 8.43 1.0063908100Chicken UnlockedRogue UnlockedThrone SitterRebel UnlockedThe Struggle ContinuesAdvanced SitterCrown Life 31 48.16
View unlocking history of this single game only
Oceanhorn: Monster of Uncharted Seas 1.2716621161CosmopolitanCatch FirebackCatch Arcadian PikeWizardShish KebabBlast'em!Hey, Big Spender! 45 40.71 1.1398113966Train WreckEncyclopedia MonstrumKnight of ArcadiaStill GoingUnspawnMasterOld Enemy 18 22.78
View unlocking history of this single game only
Odallus: The Dark Call 1.5249762535Pieces of HeartGhost KnightSilver ClaymoreUnforeseen ConsequencesFrozen MinesAqueducts Area-2Explorer 17 22.78 1.4147022963Steel Claymore"There can be only one!"Weapon BagsQuickeningWHAT ARYO BOOYIN'?NoblemanI want to believe 12 23.70
View unlocking history of this single game only
Odysseus Kosmos and his Robot Quest - Episode 1 -1 0 0.00 1.6225318909Rifle on the wallKitty kitty, JoneseyE1 - done!Hit the papers!MusophobiaEliteTaking Care of Fellow Earthlings 24 43.09
View unlocking history of this single game only
OlliOlli -1 0 0.00 1.0513544083CombododragonDizzyLocked OnLand LoverMake your MarkHalf Way ThereSo Many Points 12 23.01
View unlocking history of this single game only
Omega Strike 0.9492032528A Feast To Die ForHard HatCrazy ApeTreasure HunterLife ExtendedDrill No MoreTaste's Like Chicken 16 11.48 0.9307198524SoldierDisposedWings ClippedDethronedIntruderChampionLoot Hoarder 8 8.37
View unlocking history of this single game only
Oniken 0.9761621356Self ReferenceFirst Blood 2 1.59 0.8247818947CarnageEscape from L... the baseMost DangerousProto ThunderNo Death 1BattleshipIce Climber 30 51.44
View unlocking history of this single game only
Orbt XL 0.7132720351BorgishSunish50 PointsNeptunishUranusishSaturnishJupiterish 20 12.12 0.714296281355 PointsNear Missed!Dogeish60 PointsBlackholeishPixelish65 Points 11 8.32
View unlocking history of this single game only
Ori and the Blind Forest 1.2820553780Master of the ForestDeadly DashBash MasterPowerhouseMaster GuardianPhenomJuggle Master 45 31.87 0.7531519532AirborneNo Stone UnturnedSupersonicEliteImmortal 5 7.08
View unlocking history of this single game only
Out There Somewhere 1.3500568867Infinite runnerSwift successPermission deniedNever give upAround the worldHuge SuccessTelejump Mania 16 17.22 0.9964239597..Thanks?Teleport machine gunThis is pointlessMirror mirrorRasputinAll your base are belong to usFifth Element 20 27.57
View unlocking history of this single game only
Outland 1.4971913099Environmental ExterminatorEnthusiast 2 2.89 1.1946114302That’s TeamworkDon’t Go AloneGrand MasterTwo BirdsOverkillUntouchableSurvivor 10 17.18
View unlocking history of this single game only
Outlast -1 0 0.00 0.7295088768ILLUMINATEDFLUSHEDSOAKEDEMANCIPATEDPUNISHEDEDUCATEDPULITZER 8 8.87
View unlocking history of this single game only
Outlast: Whistleblower DLC -1 0 0.00 0.8945779204GAS LEAKERSHOCKERWHISTLEBLOWERARCHIVISTLEGACYBOWELWHISTLER 6 7.07
View unlocking history of this single game only
Overcooked 0.9638350010Closest FriendsDoes not play well with othersBest Served ColdMeals on WheelsOvercookedThe Pieces I Ate (sorry)Lettuce Begin 7 4.00 0.7264443636Kitchen NightmaresOut of this worldChef FlambeHero of ThymeAll the Trimmings 5 4.94
View unlocking history of this single game only
OVERWHELM 0.8746557236FULL POWEROVERWHELMHALFWAYWETSTEALTHDARKROCK 9 5.42 1.2020146847NEW GAME+ 1 1.20
View unlocking history of this single game only
Owlboy 1.4451993704Trinket Grand MasterTrinket MasterTreasure SeekerReminiscingGood boyFlight of the BoguinMusic Master 9 11.00 1.3087496758Ancient MemoriesOops...Treasure Seeker Grand Master 3 4.09
View unlocking history of this single game only
Pan-Pan 0.9189496636Brute forceHoarderFriendCONGLATURATION !!!Fellow traveler?ExplorerFinder 12 9.30 1.0691026449Foe 1 1.07
View unlocking history of this single game only
Papers, Please -1 0 0.00 0.3759494722Obristan TokenAntegria TokenArstotzka TokenToo HonestImpor TokenHired RifleKolechia Token 13 11.13
View unlocking history of this single game only
Paranautical Activity: Deluxe Atonement Edition -1 0 0.00 0.7885716558Good StartChosen OnePaddedProgressTyrusUnsure FootingNazi Hell 45 95.04
View unlocking history of this single game only
PAYDAY 2 -1 0 0.00 0.1068976223No One Cared Who I Was...No Turning BackHow Do You Like Me Now?You Gotta Start SomewhereTip the ScalesGuilty of CrimeWould You Like Your Receipt? 685 927.76
View unlocking history of this single game only
Phantom Trigger -1 0 0.00 2.1366608143Weapon MasterIt's All Your FaultBrainiacHelping HandInsanity from the beginningIt's Cold in HellI'm All Alone 16 28.09
View unlocking history of this single game only
Pharaoh Rebirth+ 1.3943494558Free-fall MasterFighterStealth StepExtra Stage ClearAnubis30 Aerial25 Aerial 24 17.19 1.2871394157Rank SRank ACollectorRank BCar GOCar Expert 6 8.52
View unlocking history of this single game only
Pid -1 0 0.00 0.6062552333The first memoryYoung CartographerBothersome guestJunior ExplorerLittle guestGoodbye little guestSenior Explorer 12 21.03
View unlocking history of this single game only
Pix the Cat -1 0 0.00 1.3010959625PERFECTAMUNDOTOP 100 GANG!TOP 10 CREW!I GOT A FEVERB&W PRINCEFOCUS... STEADY...B&W KING 11 23.54
View unlocking history of this single game only
Pixel Puzzles 2: Anime -1 0 0.00 0.6924800277Puzzle 1 CompletePuzzle 4 CompletePuzzle 3 CompleteDL-TV Puzzle CompletePuzzle 8 CompletePuzzle 18 CompletePuzzle 11 Complete 27 24.96
View unlocking history of this single game only
Pixel Puzzles Ultimate -1 0 0.00 0.9073814154Lets Get PuzzlingTutorial Complete!Puzzling Begins Here!1st Puzzle Complete!100 PIECES PLACED!Zen PuzzlerGotcha! 364 748.26
View unlocking history of this single game only
Pixel Puzzles: UndeadZ -1 0 0.00 0.7914199829Puzzle 1 CompleteChomp ChompNade ThrowerPuzzle 2 CompletePuzzle 3 CompletePuzzle 4 CompletePuzzle 5 Complete 34 34.13
View unlocking history of this single game only
PixelJunk Eden 2.0048141479Garden 10: CompleteGarden 07: CompleteAll Gardens Clear (Garden 01 - 10)Garden 06: CompleteThirtysomethingGarden 05: CompleteFifteen Crystals 26 32.91 1.5623416901All Seeds 03All Seeds 05All Seeds 04Prowler Mach 500Bank ShotAll Seeds 06Zero-G 35 74.01
View unlocking history of this single game only
Planet Ancyra Chronicles -1 0 0.00 1.6502406597I met Mr.HartI met Mr.VaughnI met an EngineerI met a crateI met a forestI met Ms.AlixI met Mr.Bernard 28 56.10
View unlocking history of this single game only
Planet Diver 1.8176491261Centauri ExpertSuit ShopperCentauri RegularCentauri HobbyistCentauri HeroCentauri ExplorerCentauri Novice 9 14.12 1.6962269545Big Game HunterBuddy TinkererCentauri VeteranCalypso NewbieCentauri JockCalypso NoviceCalypso Star 43 101.72
View unlocking history of this single game only
Poly Bridge 0.3341479301Tutorial Completed 1 0.33 0.6524832845Completed Alpine MeadowsCompleted Alpine Meadows Under BudgetCompleted Alpine Meadows Under Budget and Under 100% StressCompleted Desert WindsCompleted Desert Winds Under BudgetCompleted Desert Winds Under Budget and Under 100% StressCompleted Snow Drift 21 35.46
View unlocking history of this single game only
Prismata -1 0 0.00 1.5794789791Outbreak CompleteDefenderOptimal BlockingSuper SpectatorSo Much DefenseBeginner Scenarios CompleteStream In My Sights 114 238.15
View unlocking history of this single game only
Psychonauts -1 0 0.00 0.6044866443Your Last Chance to Chicken OutA Victory for Good TasteJunior PSI CadetRolling Rock StarFor Insurance ReasonsRegular PSI CadetHoliday Dinner 37 45.07
View unlocking history of this single game only
Punch Club 0.4446916580Prevention of a crimePizza eaterMeet CaseyMeet ApuMeet SilverMeet MickFirst fight 7 2.66 0.4575158954Meet TylerA friendUltimate fightsTraining resultsTake the challenge