]> Achievement Stats » Profiles » FaruSantos

FaruSantos

Completion progress
Loading...
Rank 19596
Achievements 2004 (1676.99 points)
Number of games and DLCs 365
Number of all owning games 448
Badges 237 (31164 XP)
Member since January 11, 2008
Total playing time 1997.0 hours
Completion rate 0.6 %
Location Brasilia, Distrito Federal, Brazil
Real name Farley Santos

Show / hide summary

Achievements

Game Unlocked achievements Locked achievements
Current best # Points Next easiest # Points
1001 Spikes -1 0 0.00 0.9979152679I AM ONLY A MANHerro!A Strange DreamYes, I Can!Dead WalkerGolden BoyOnesan 25 37.56
View unlocking history of this single game only
12 is Better Than 6 -1 0 0.00 0.4876855910The first stepI can shoot!I shoot quite well!Noiseless Mexican...Filcher...good MexicanWhat was written there? 46 37.13
View unlocking history of this single game only
12 Labours of Hercules -1 0 0.00 0.3851962090Gold reserveFirst GoldTricksterManual DexterityJugglerAthleteDiligence 22 12.12
View unlocking history of this single game only
16bit Trader -1 0 0.00 1.3915990591Sea DogA Small ArmyPiousA Brave HeartAn Honest ManBig GunEnlightened Mind 16 23.77
View unlocking history of this single game only
8-Bit Bayonetta 0.5898529291NinjaHigh RollerAddictedBonusBullet BalletZeroBouncy 12 5.32 0.5064780712Unlimited AmmoVery SpecificBayonettaHigh Score 4 2.46
View unlocking history of this single game only
80 Days 1.210176467970 Days20 Cities80 DaysCompleted TripThe World's Fair 5 4.96 1.3054021597No BanksTake That Varmit60 DaysLightweight ChampionThe Ocean FloorSaved from the Noose30 Cities 30 56.85
View unlocking history of this single game only
AaaaaAAaaaAAAaaAAAAaAAAAA!!! for the Awesome -1 0 0.00 0.8369029164I am One in a Million, and There Are Six Thousand People in the World Exactly Like MeI Have Come to The Point in My Life Where I Appreciate Christmas Mall MusicOne Fewer Than a Lewd Innuendo Because We Are Totally Past That PhaseI Have Jumped Beyond the Powers of Two, and Have Lived to Tell the TaleI Have Broken More Glass Than a Finely Corpulent Opera Singer, and Love Myself For ItI am at Risk of Contracting Mononucleosis, Which is Known Colloquially as the Kissing DiseaseOooooOOoooOOOooOOOOoOOOOO!!! -- O Ooooooooo Ooooooooo ooo Ooooooo 10 14.40
View unlocking history of this single game only
Absolute Drift 0.5026245117Hoon Airlines 1 0.50 0.7675381303Jelly DonutsSpin DoctorMaverickGood SkillsBring the Cubic RuckusDouble RainbowMaster Drifter 19 20.79
View unlocking history of this single game only
Action Alien -1 0 0.00 1.1881827116Journey Routine(Almost) Under ControlCow-BoyRationingDemomanThe 2nd AmendmentWarm Trip 19 26.91
View unlocking history of this single game only
Adventures of Shuggy 0.7594246864Shmu HerderMaster Of Time 2 1.46 0.9576591849Dungeon PerfectionistBoiler Room PerfectionistNinjaCastle ReclaimedGallery PerfectionistGraveyard PerfectionistClock Tower Perfectionist 11 15.50
View unlocking history of this single game only
Aegis Defenders 1.4926626682Master RuinhunterSamurai KickerBig SpenderSaved a PrincessReunitedHit Rock BottomDefended Aegis 28 34.16 1.8906025887MachineThe ClarentDeathless 3 5.67
View unlocking history of this single game only
Agent Awesome -1 0 0.00 1.0521011353Intelligent Life DetectedBig SpenderTottally not racism.Guns don´t kill people ISeriously?Guns don´t kill people IINo more TPS Reports 39 60.52
View unlocking history of this single game only
AI War: Fleet Command -1 0 0.00 0.84747898581. Rainy Day Savings: 50,000 Energy1. Warmup: 1 Hour Campaign5. Maxed Out Resources1. Future Proofing: 150,000 EnergyHeat Wave Brown OutIn The Midst Of A Cold, Dark Winter1. Control 2 322 674.71
View unlocking history of this single game only
Airstrike HD -1 0 0.00 1.0027810335SurpriseStargazerMechanicCombat flightMassive TargetSniperPresent box 12 16.10
View unlocking history of this single game only
Alpha Runner -1 0 0.00 0.7365547419YOU DID NOTHING AWARDGetting StartedYou triedJump AroundWarmed upFun KillerNot again 20 21.95
View unlocking history of this single game only
Amigdala -1 0 0.00 1.2753440142Conspiracy theoristArdentNosyTrouble seekerLuxInquisitiveBookworm 15 25.83
View unlocking history of this single game only
Amnesia: A Machine for Pigs -1 0 0.00 1.4536528587The TeethThe ThroatThe GutThe EntrailsThe HeartMaster ArchivistInsanity 7 10.96
View unlocking history of this single game only
Amnesia: The Dark Descent -1 0 0.00 1.4180198908NOPEAlchemistEscape ArtistDescendantPipeworkerRestorerSurvivor 18 32.01
View unlocking history of this single game only
Ampu-Tea -1 0 0.00 0.5163245201Getting Thirsty...Smashing!You broke it, you pay for it!Flipping the tableKeep Calm, Make TeaRAGE QUITJust a spoonful of sugar... 11 8.69
View unlocking history of this single game only
Anomaly 2 -1 0 0.00 0.7376674414First BloodTwo In OneDoomsday Weapon SpecialistGold StandardLittle CollectorArmor of SteelVR Is Overrated 65 115.38
View unlocking history of this single game only
Anomaly Korea -1 0 0.00 1.0410624743ThreatCollectorTop GearWar MongerMy Private ArsenalPocket changeFire away! 35 56.88
View unlocking history of this single game only
Anoxemia -1 0 0.00 0.95599257951st deathI must complete the missionTreasures!Mark?Oxygen10th deathI’ve got the power! 23 39.90
View unlocking history of this single game only
Aqua Kitty - Milk Mine Defender 1.4331723452Super Dodger BreakerEspresso Piccolo - NormalCraboid ObliteratorMouthfish HunterSuper Paleofish WreckerPuffaboom PopperAngelfishy Smasher 12 12.67 1.2188692093Irresponsible GuardianEspresso Piccolo - EasySuper Chain MasterSuper Shot SpreaderOne DirectionFurry NavigatorEspresso Medio - Easy 24 45.38
View unlocking history of this single game only
Armello 1.6002863646Baned-AidForce of NatureAlphaThe Fresh PrinceBully MammothSiege SpecialistDark Temptation 30 30.08 0.8985140324DiplomatDown the Rabbit HoleArmed & DangerousMistrialLoose ChangeAll-Seeing EyeThunder Dome 20 29.74
View unlocking history of this single game only
Assault Android Cactus 1.3100447655Well ReadAndroids AssembleUntouchableTo Cross The VoidEverything's CactusPerfectionCollateral Damage 17 15.49 0.8720445633Chain ReactionWe Have To Go DeeperNothing But NetMaximum OverdriveArt ConnoisseurScrambled EggsI Am Become Death 12 19.65
View unlocking history of this single game only
Atlas Reactor -1 0 0.00 1.5981208086Massive AttackEye of the StormLevel 50CalculatedShield to the FaceThe Power of FriendshipHuntmaster 121 232.99
View unlocking history of this single game only
AX:EL -1 0 0.00 1.0585943460BuilderFireBallBird HunterSpy HunterNo MercyACEPrototype Tester 22 31.89
View unlocking history of this single game only
Azure Striker Gunvolt 1.0215405226My Songs Will Be Your WingsOne With the LightningHasta La VistaBig Bad Electro Middle SchoolerTogether With JouleSumeragi RunIt's My Hobby!! 7 4.76 1.3618711233Mantis, Move Out!Tanks Aren't Supposed to Jump!!Master of the 7 DragonsOversurge! Azure Striker!The Muse's VoiceIt's My Secret Love Technique!!The Lamest of Lame... 18 27.66
View unlocking history of this single game only
Back to Bed 1.2303243876No Time to Explain!Groundhog NightUnderstanding the Basics 3 3.01 0.9527204037The Button is Stuck!Deeper Into the DreamPatience is a VirtueGrown AttachedIf at First You Don't SucceedCheckmateNow You are Thinking With… 17 20.76
View unlocking history of this single game only
Bad Hotel 1.1632103920CulledSurf and TurfTenementClear SkiesOn Time, On Budget! 5 4.44 1.0368063450Thrifty BuilderTrigger HappySkyscraperToothlessCity SlickerMaster of the UniverseTop Trump 8 10.30
View unlocking history of this single game only
BARRIER X -1 0 0.00 0.9292871952Let's start the journeyHmm, that was easy!Let the Hunt Begin!One More TimeGrand ExterminatorUnstoppableYOU ARE A MONSTER! 7 9.28
View unlocking history of this single game only
BATTLECREW Space Pirates -1 0 0.00 1.1669950485Welcome to TortugaAway boarders!!!First victoryBloody pirateBuccaneer of the dayTreasure fleetPirate on fire 20 34.85
View unlocking history of this single game only
Battleplan: American Civil War -1 0 0.00 1.3935075998Engineer: built a bridgeBridge Burner: destroyed a bridgeTaken: held any battlefield objective that you didn't start the battle withStudent of War: watched all TutorialsUnion Militia Victory Pittsburg LandingUnion Militia Victory First Bull RunPlunderer: destroyed enemy supplies 95 181.42
View unlocking history of this single game only
Bear With Me -1 0 0.00 0.9479188919Arts And Crafts!I'm Into Heavier Stuff!Product Placement!Laughing Stock!Around The World!Fear Of The Dark!The Dynamic Duo! 75 104.74
View unlocking history of this single game only
Beatbuddy: Tale of the Guardians -1 0 0.00 0.9746419191Beatbuddy SwingSnare JumperLove SwingIn the RhythmMad on HealthLost In YesterdayDash Maniac 15 24.89
View unlocking history of this single game only
Between Me and The Night -1 0 0.00 0.9998746514Why was it so dark?It’s snowing…It seems like only yesterday.I’m getting the hang of this.I can’t leave this here.Forever young.Welcome to the real world. 18 26.35
View unlocking history of this single game only
Binary Domain -1 0 0.00 0.6485227346Seek and DestroyWeapon CrafterWater SliderSpendthriftHIT AND RUNA Friend IndeedJackpot 49 64.80
View unlocking history of this single game only
Bionic Dues -1 0 0.00 1.0623255968A Rogue With No Points In Subtlety (Casual)A Rogue With No Points In Subtlety (Easy)A Rogue With No Points In Subtlety (Medium)A Promising BeginningSimple Battery (Casual)Simple Battery (Easy)Take That, Metal Man! 220 453.83
View unlocking history of this single game only
Blade Ballet 1.1773922443Impeccably OrdinarySituation Under ControlThat Evil ThingSniped! 4 4.27 0.90439093119 LivesBreacherThe Baddest De-CorkerConscientious ObjectorFerocious FelineCyclone of Death!Peerless Lancer 14 22.05
View unlocking history of this single game only
Blaite -1 0 0.00 0.9781262279Welcome!You already learned to play!You thought it was easy, right?Rematch!Team workChapter 1 6 7.00
View unlocking history of this single game only
Blitz Breaker 1.4864897728SILVER STARRETRY AWARD 2 2.85 1.5523071289SCORE CENTRICFUNDING AWARDGOLD STARVICTORYSCORE CENATENACITYGREEN STAR? 11 20.00
View unlocking history of this single game only
Block N Load 0.8453191519The Token CollectorPractice Makes PerfectSweet Taste of VictoryDown the Rabbit HoleOne Block at a Time 5 2.72 0.4512179792And so it begins…Crossed the LineHenshin!The Bricks Must Flow!The Grey PilgrimBuddy Up!Mole Machine 61 86.04
View unlocking history of this single game only
Block'hood -1 0 0.00 0.5096265674Chapter 1Chapter 2People 1JourneymanPeople 2Chapter 3Basic Tutorials 39 52.29
View unlocking history of this single game only
Blockstorm -1 0 0.00 0.6920069456Stroke of luckJust One ChanceCarpe DiemPull!ScapegoatTrampolineRage Quit! 131 284.68
View unlocking history of this single game only
Bloop Reloaded -1 0 0.00 1.3843538761Happy DayForce PullerMeteor CollectorThe ThinkerMap CreatorMixerHalfway there 11 17.17
View unlocking history of this single game only
BLUE REVOLVER 0.7166613340HASKEL Clear! [Hyper]Mission CLEAR!Supplies DeliveredHASKEL Clear! [Normal]DELPHI Clear! [Hyper]The BeginningEXTEND! 11 4.63 0.6001557708YASUMI Clear! [Normal]The AscentThe PerfectionistLUNA Clear! [Normal]Fully StockedNORMAL Clear!ZEALOT Clear! [Normal] 29 41.06
View unlocking history of this single game only
BoneBone: Rise of the Deathlord -1 0 0.00 1.0097669363New HandsBull's-EyeYou Shall Not Pass!Our HopeThe Dead Should Stay Dead!Little ArmyPower of Crossbow 18 23.00
View unlocking history of this single game only
Bot Vice 1.0721485615Clean ShootingGungirlA-GentFearless Thunder 4 3.80 1.1646178961Boulder DodgerBlastingShot-ChopRevengerThe RipperRocket WizardDancing in the Beamlight 29 39.56
View unlocking history of this single game only
The Bridge -1 0 0.00 0.4749151766ThinkerAcademicScholarAftermath-InverterRunnerChallengerBridgewalker 20 21.63
View unlocking history of this single game only
Broken Age -1 0 0.00 0.8276618123Please Don't Tell AnyoneWhoops!She's Doomed Us AllThere Is HopeQuestion Your Elders"My Lightness!"Mother and Child Reunion 45 52.15
View unlocking history of this single game only
Brütal Legend -1 0 0.00 0.4293716252Got a Car and a DateStart a RevolutionThick as a Baby's ArmOne Hit WonderHair RemoverFrench Kiss InstructorChicks n' Booze n' Stuff 59 86.43
View unlocking history of this single game only
The Bureau: XCOM Declassified -1 0 0.00 0.6173455119All That RemainsDead HeadBringing down GoliathThe Last Suit You'll Ever WearIs He Old Enough to Drive?So Just Let Me Introduce MyselfAway Team 34 37.96
View unlocking history of this single game only
Burgers -1 0 0.00 1.0556167364Body PilesCar WreckerBetter Keep Your Head DownA cure for all ThisAssault Rifle 5 5.69
View unlocking history of this single game only
Card Hunter 0.4046956301Adventurer 1 0.40 0.8437761068CollectorAllySlayer of MelvelousRookieDefender of WoodhomeBounty HunterFairy Finder 49 95.49
View unlocking history of this single game only
Castle Crashers 0.3317976594Melee Is Best 1 0.33 0.5667375326Maximum FirepowerDeer TrainerTreasure HunterTraditionalMedic!The TraitorKay Eye Ess Ess 11 11.84
View unlocking history of this single game only
Cataegis : The White Wind -1 0 0.00 1.3641268015More to ComeMissile DividerFried FlierSplit SpearsTowards the ZigguratBring ItDead Necromancer 41 75.55
View unlocking history of this single game only
Cave Story+ 1.3419024944Happy Birthday Pixel!I'm Juggernaut...CowardPanty RaiderShtuff HappensEvil to the CoreMuscle, MD. 37 26.41 1.0500903130Ladies' ManTow Me A RopeLittle ManSo easy, so so easy!What A Fun Guy!Ducking AwesomeI've Got Your Back 39 68.17
View unlocking history of this single game only
Caveblazers 1.0084794760Super Powered!The Harder They FallBrute ForceExecutionerCaveblazin' 5 3.91 1.1692187786BestiesQuafferArena ChampionGiant SlayerHabitual CaveblazerComplete!Historian 16 31.28
View unlocking history of this single game only
Cavern Kings -1 0 0.00 50Trophy KingTreasure KingCavern KingFriendly KingWeapon KingHeart of BelialAces 36-36 0.00
View unlocking history of this single game only
Celeste 0.79405951501UP!Center of the EarthGolden FeatherQuiet and FallingGood KarmaHeart of the MountainScattered and Lost 23 10.37 0.6186009049Heavy and FrailMirror MagicPink SunriseNo More RunningSay GoodbyeImpress Your FriendsThanks For Playing 9 8.41
View unlocking history of this single game only
Chasm 1.4506691694PrizefighterBone WormWendigoWarrior 4 3.77 0.9954714179Monster SlayerTitanKing TrellBig SpenderShamanGladiatorSuperhero 16 20.78
View unlocking history of this single game only
Chivalry: Medieval Warfare -1 0 0.00 0.5219789743Reach level 5Vultures ChefTwo handed weapon UnlockedBastard weapon UnlockedReach level 10One handed sharp UnlockedPolearm Unlocked 49 57.45
View unlocking history of this single game only
Chompy Chomp Chomp -1 0 0.00 0.9575444460Yellow ChainPurple ChainChompyAlternating Bonus 2Alternating Bonus 1ChomperDeathwish 27 34.55
View unlocking history of this single game only
Clicker Heroes 0.4301320910Bounty: The Green OneMass MurdererNeverendingZone OwnerTerminatorBoss ExterminatorMentor 31 7.13 0.3904582858Broken MouseAgain and AgainBounty: Woodchip, the RodentBounty: Queen of BloopsLevelupperBounty: Doppler, the RobotFinger Amputee 80 71.78
View unlocking history of this single game only
Clustertruck -1 0 0.00 0.2663526833The RudeDeck the trucks!King Of The ForestBelow FreezingRave OnOld SchoolMaster 19 12.94
View unlocking history of this single game only
Company of Heroes 2 -1 0 0.00 0.5869918466M.01 - German EngineeringCampaign ConscriptStalingrad Rail Station - ConscriptSenior PrivateComp-Stomp ConscriptM.01 - Compassion in WarScorched Earth - Conscript 378 585.51
View unlocking history of this single game only
Cortex Command -1 0 0.00 0.6739210486Hello There!So That's What It's AboutTechnical WinAren't You CleverThese Guys Are Awesome!Pyrrhic VictoryOne Star General 11 15.63
View unlocking history of this single game only
CPU Invaders -1 0 0.00 0.92249923941234100056 13 14.55
View unlocking history of this single game only
Crab Dub -1 0 0.00 1.0276049376CrabMagic pillJellyfishLittle duckSpaceKittenRocket 18 22.21
View unlocking history of this single game only
Crawl 1.6578153372A Death FeudThe GamekeeperVermin's ScourgeThe Acclaimed CollectorThe Lonely MiserThe Novice ScholarA Taste For Revenge 7 9.86 1.9088672400The Wealthy MerchantA Vengeance InsatiableBrain HaemorrhageInfinite HorrorUnceasing LethargyThe BeastmasterReanimator 38 92.28
View unlocking history of this single game only
Crazy Taxi -1 0 0.00 1.1613900661Arcade C-licenseOriginal C-licenseArcade B-licenseArcade A-licenseArcade S-licenseOriginal B-licenseOriginal A-license 12 18.72
View unlocking history of this single game only
Crossing Souls 1.0672124624A popular dudeMaster SplinterHunted ChameleonGo to hellFor the greater good...Tell us another story, GrandmaRusty heart 21 17.43 0.8748875260Evil babyWhat were you staring at?!Roy, I'm already insideAn exemplary studentUnbounded interrogationLast wordsInscriptiana Jones 11 13.38
View unlocking history of this single game only
Crusader Kings II -1 0 0.00 0.9180369377The Marriage GameFull HouseAlways Bet On DukeUntil Death Do Us PartRoyal BloodIt's Good to be the KingExalted Among Men 32 50.31
View unlocking history of this single game only
Crypt of the NecroDancer 0.7727187872In The Zone (3)In The Zone (2)In The Zone 3 1.72 0.7372545004MerchanticideHeartthrobIn The Zone (4)Friendly FireSo Hardcore!A Beatless BeatdownLute that Loot 25 42.88
View unlocking history of this single game only
CRYPTARK 1.6018071175Assimilated OutsiderResidual FungusReclamation GrinderCybernetic Prosthetic 4 5.45 1.0535386801Processed OreAlien ArtworkExploratory ProbeAncient Support StrutAssimilated OutsiderStar Map FragmentFossilized Skeletal Remains 23 34.42
View unlocking history of this single game only
Cubetractor -1 0 0.00 1.6731872559Placer of the CubesCritter HunterCubeXaminatorSteamrollerA touch of CubeManshipBipolar CubeXpeditionAs if that weren't enough! 13 25.67
View unlocking history of this single game only
Cuisine Royale -1 0 0.00 1.3143954277Ready to fight!First bloodThe dinner is servedThe invisible manUnstoppableGunslingerThe king 13 28.97
View unlocking history of this single game only
Curses 'N Chaos 2.2483811378Bounty HunterSilly Movie ReferenceFallen StarGrave SituationWasteland WarriorCastle CrashedCollector 19 41.05 2.3355312347Elite FighterAgent of Chaos 2 4.67
View unlocking history of this single game only
Dandara 1.8398762941Seasoned ExplorerIn the mercy of SaltStories of FreedomSalt's RealizationThe Secret of the DreamsThe Intention SideWide open face, hidden heart 11 17.71 1.8213928938In the favor of SaltThe Salt LeaperIn the command of SaltThe Treasure HunterThe CompletionistNo DistractionsNo Hand-holding 9 18.17
View unlocking history of this single game only
DarkEnd -1 0 0.00 1.7119700909Into DarknessCorrupt No More!The Princess is in another castleBeginnerHeigh-Ho!ItJust a Pebble in a Pot 26 50.08
View unlocking history of this single game only
Darkest Dungeon® 1.2604167461Two years of this...In Sheep's ClothingLike lambs to the slaughter...Gnawing hunger sets in...Murder of CrowsValiant sacrifice...That'll do, pig... 50 32.26 0.8567856550What is already Dead Cannot DieThe abbey my Ancestor once knew...Restored to its former glory...Lone survivorBlocked from life...We return to the worms of the earth...Four on the Floor 19 28.19
View unlocking history of this single game only
Darkest Dungeon®: The Color Of Madness 0.7371483445Time Is A Flat CircleBlue Skies AheadTears Lost In The DustThe Blinders Are LiftedA Merciful ActA Taste Of Madness 6 2.90 0.3449676037There Are No WordsA Poor HarvestBeyond The InfiniteThis Is NothingA Hollow ReckoningLining the Jeweller's PocketsPlowshares To Swords 14 13.47
View unlocking history of this single game only
Darkest Dungeon®: The Crimson Court 0.7125870585Happy TogetherJailbreakWhat Strange BedfellowsAn Unexpected PartyFrom Rubble to RabbleSymptomsThe Flesh is Willing 7 3.73 0.7516378760Les Jeux Sont FaitsZealous AccusationExpiredJust the ChequeThe Red HookHer Last DanceShadows Blur Together 8 8.71
View unlocking history of this single game only
The Darkness II -1 0 0.00 0.4615369141Jackie's Got TalentCheque Please!I'm Just Getting StartedMmmm Essence!Escape the BrotherhoodStorm the MansionOne Flew Over... 50 49.37
View unlocking history of this single game only
Dead Cells 0.7841317654Incy Wincy…Fortune and glory, kid. Fortune and Glory...Faster than light!Is there something in your eye?La BruteGoing down!The dead center of the island... 29 12.05 0.6132835150Blade MasterSee, that wasn't so hard now, was it?Please leave your shoes at the entrance.Bend the knee? I think not…Surgical extractionEven the rats avoid the place...The last rampart falls... 26 35.95
View unlocking history of this single game only
Deep Dungeons of Doom 1.5667433739OccultistArcadeBeast SlayerDead by DawnMonopolyInvestigatorUndead Slayer 18 18.41 1.1969109774Barely a ScratchUndyingBeowulfMerciful BlowIt's not Safe hereHeroMaking Savings 28 49.29
View unlocking history of this single game only
Deep Sky Derelicts -1 0 0.00 0.9530932307Errand BoyFlawless VictoryRust in PeaceNo Time WastedFirst of ManyFully ProficientGlorious Monuments 54 85.19
View unlocking history of this single game only
Defend The Highlands -1 0 0.00 1.4134149551Warrior of the HighlandsBagpipe PlayerMasteryThane of the HighlandsFearsome LeaderMashed PotatoHat Trick 40 73.26
View unlocking history of this single game only
The Descendant -1 0 0.00 1.0137246847At World’s EndI've Got a Bad Feeling About ThisBig Bada Boom!Master of NoneAt Episode’s EndSimmer DownHostile Work Environment 10 12.21
View unlocking history of this single game only
Destiny Warriors -1 0 0.00 1.3401007652Ring-a-Ding-DongWanna meet that dadDefeated IkiboBrother FightPart TwoTil Next Time 6 8.73
View unlocking history of this single game only
DiRT 3 Complete Edition -1 0 0.00 0.5248180032Into the DiRTReputation BoostToday's Forecast is...Victory!Rising TalentDriving SchoolKick Off the Training Wheels!Watch the Paintwork! 60 87.26
View unlocking history of this single game only
DISTRAINT: Deluxe Edition -1 0 0.00 0.8717612624The First DistraintCoffee, Please!The Fire MakerThe Second DistraintWhere Is Your Dignity?The ElectricianSniff This! 16 16.75
View unlocking history of this single game only
Divide by Sheep 0.7721573710Om nom nomWill it float? 2 1.48 0.9045238495SplatHello WorldWho put these lasers here?It's a trap!Stay frostyIce Ice BabyWill it burn? 17 22.42
View unlocking history of this single game only
Downwell 1.3823939562So Many GhostsSo Many FrogsSugoi ComboBye WellGround AllergySaving UpBye Stuff 16 12.92 1.4069061279FrugalitySo Many SquidsSo Much StuffWell Master 4 6.07
View unlocking history of this single game only
Duelyst -1 0 0.00 0.7235496640Journeyman QuestorHelping HandEntering The GauntletBest of FriendsEpic QuestorWorld ExplorerThe Art of War 10 10.32
View unlocking history of this single game only
Dungelot : Shattered Lands 0.9011154771Skeleton Archer SlayerMonster SlayerFamous Bounty HunterHell of a DietWealthFrom Dusk till DawnVeteran 22 14.12 0.7528426051Undead BeefNovice ArmorerGathererGoblin SlayerWizardZombie SlayerYou no take candle! 35 38.69
View unlocking history of this single game only
Dungeon Defenders II -1 0 0.00 0.3924923837Defender InitiateForgot to HealDefense ProdigyVeteran DefenderTriggered My Trap CartBomb SquadBuster Cannon 18 21.06
View unlocking history of this single game only
Dungeon of the Endless 2.0474970341Champions' LeagueEndless DayGuns 'n GloryScience Fair WinnerGraduated Med SchoolDust HoarderMedpack Addict 18 19.37 1.0316203833Real Heroes Don't PauseThe Other Great EscapeRocket ScientistDexterousBookwormMembers OnlySoiled with glue 11 19.51
View unlocking history of this single game only
Dungeon Souls 1.1163276434I Am Now Ready! 1 1.12 0.9526319504Indiana Jones'dPuny Skeleton KingKeep 'Em Coming!The Whole Crew's Here!Good ArchitectureFreedomGold Swimming 9 12.06
View unlocking history of this single game only
Dungeons 2 -1 0 0.00 0.8705134988Little SnotUgh, Daylight!The King is Dead, Long Live the Evil!Stay and fight, you coward!Cleaned out the Crystal ChamberMine SuperintendentThe Last Unicorn 25 33.42
View unlocking history of this single game only
Dust: An Elysian Tail 0.9958813787Savior of FalanaOne Last WishThat's More Like ItOpposite of FailAn Impressive DisplaySilence Those GunsRenegade 25 16.50 0.8798350692Blue BomberBad TherapistBaker's DozenAbove and Beyond the CallThe Stuff of Legends 5 5.40
View unlocking history of this single game only
Dustforce -1 0 0.00 2.4042572975Double S+ 1 2.40
View unlocking history of this single game only
Eador. Masters of the Broken World -1 0 0.00 1.0412694216The Obnoxious CompanionThe Glorious OpeningA Career in the MakingThus Began the EmpireReanimationThe Royal GuardPersistence and Diligence 56 90.03
View unlocking history of this single game only
Endorlight -1 0 0.00 50Developer achievement 1-1 0.00
View unlocking history of this single game only
Enemy Mind -1 0 0.00 1.1149532795Beep Beep!EnsignLeap of FaithEmpathic ConditioningLieutenantReflectionsVeteran 34 66.52
View unlocking history of this single game only
Energy Balance -1 0 0.00 1.0962589979Begin0,33333330,6666666Almost thereMeowie fixedHardcore halfFull hardcore 9 14.73
View unlocking history of this single game only
Energy Cycle -1 0 0.00 1.1512538195The beginning of the cycle25% CycleFirst level created!50% Cycle75% CycleCycle complete!Layer #10 9 13.46
View unlocking history of this single game only
Enter the Gungeon 1.3309659958RiderGun GameGreat HallTrickshotCartographer's AssistantBeast MasterBeep 33 28.56 0.8444372416Biggest WalletReverence for the DeadJammedExorcistTime ParadoxGoing DownestHollowed Out 21 26.06
View unlocking history of this single game only
Epistory - Typing Chronicles 0.8973883390MarathonStatic Shock1% Muse: Pride and PrejudiceMultitaskingDrowning Halls1% Muse: Foundation1% Muse: Frankenstein 21 14.62 0.8387367129The quick brown fox...1% Muse: For Whom the Bell TollsIce MausoleumCreation CityWinds of ChangeTypistSlayer 34 39.64
View unlocking history of this single game only
F1 2015 -1 0 0.00 1.2563211918Me, Myself and IPole Sitter1, 2, 3, PodiumOne AimOne with the CarTotal RecallOnline Winner 45 70.35
View unlocking history of this single game only
Faeria -1 0 0.00 2.1777250767Welcome to Faeria!Mission completeSlayingTo the FaceSkilled AdventurerBurnSlaughter 59 158.57
View unlocking history of this single game only
FaeVerse Alchemy -1 0 0.00 1.0755773783Chaos AwakensAbyssal ConvictionChaos MoteChaos FaerieAbyssal KnightChaos NoviceAbyssal Monarch 15 22.87
View unlocking history of this single game only
Fallen Enchantress: Legendary Heroes -1 0 0.00 0.6551378965Built a CityMonster KillerRecruited an NPCDefeated an ArmyAdventurerExplorerExperienced 54 80.00
View unlocking history of this single game only
FAR: Lone Sails 0.8410482407A piece of HomeThe Sound of SilenceMy Heart will go onThe answer to life, the universe and everythingHoarderGoodbye old FriendPimp my Ride 11 4.82 1.0454394817Fire in the Hole!I got 99 minutesIt’s over 9000! 3 3.58
View unlocking history of this single game only
Fidel Dungeon Rescue 1.3822212219Nobody dare touch my grandmaChew a MimicEat 4 PlantsSecret LevelFlashbackDying a lot is fine 6 7.11 1.2158695459Good Dog!CheckmateParty is OverDead dog CAN barkFidelNo ZappingBAD DOG!!! 19 32.55
View unlocking history of this single game only
Figment 1.6197317839NostalgiaChecking the GearsBlademasterWaterboyLovecraftian ShenanigansOvercoming FearComing Back to the Surface 16 23.17 1.4653596878ExterminatorNoisy NeighborTime for TeaSeeking InspirationDistant MemoriesTurning on the LightNow it all Makes Sense! 7 11.13
View unlocking history of this single game only
The Final Station 0.5496677160Station A-45 1 0.55 0.6201441288Push BackSide EffectsCollateral DamagerYes You CanHome SafeThe L-abs BunkerCity of The Factories 22 32.46
View unlocking history of this single game only
Fire With Fire: Online Tower Attack and Defense 1.1501311064Fire Safety 1 1.15 2.1629683971Sweet Burn SpotfireSweet Burn Blue GiantBlaster Fire ExtinguisherSweet Burn Triple FissionSweet Burn NagaSeeker Fire ExtinguisherSweet Burn Spitfire 30 75.07
View unlocking history of this single game only
The Flame in the Flood 1.9518774748Animal FriendThe KingdomThe Path UpPack RatHigh GroundI been everywhere, manSnake Charmer 10 14.53 1.4697498083ForagerInvincibleBy A ThreadField MedicCan Bearly Take ItSeamstressMechanic 26 47.83
View unlocking history of this single game only
Flinthook 1.4981783628Liquified Von GuuBronze Infinite RunSpace CaptainQuarter MasterPlucked GoldfeathersRoastedTwitch 9 10.00 1.2730642557Silver BullseyeFast PluckerGolden BullseyeShipwreckerSilver GoldfeathersSilver Infinite RunRumbled Grimble 28 47.55
View unlocking history of this single game only
Forge of Gods (RPG) -1 0 0.00 0.7217012644New GodStart of the journeyAlter EgoWe're gonna be richRank UpCastle is my houseFirst Blood 58 78.44
View unlocking history of this single game only
Fork Parker's Holiday Profit Hike -1 0 0.00 0.6081992984Fork ParkerProfits Are DownBase CampFork ParkourHR ViolationVertical IntegrationThe real Fork Parker starts here. 17 23.42
View unlocking history of this single game only
Fortified -1 0 0.00 1.2824714184Ivy LeaguerGoose It!Big SpenderReporting For DutyIce to Meet YouBring Him Down!Circuit Breaker 23 38.02
View unlocking history of this single game only
GALAK-Z 1.7756279707My Shields Are Blown!Darkest Before DawnGolden WingsDon't Mind Me 4 4.75 1.4739902020Variable FighterThat Would Be StealingTreasure HunterMetamorphosisEye of the StormShields Are For Wimps!Thieving From Thieves 31 73.63
View unlocking history of this single game only
Gemini Rue -1 0 0.00 0.9228557348DiplomacyGeminisGive me a Hard CopyRue the DayStair masterGood SamaritanMemories 15 20.85
View unlocking history of this single game only
Giana Sisters: Twisted Dreams -1 0 0.00 0.4421639144Dream TwistRuby-Red PirouetteCitrine CannonballA Flurry of FeathersA Brush With DeathSoft LandingShell Shock 25 44.19
View unlocking history of this single game only
Gone Home -1 0 0.00 1.3965358734Gone HomeNesting InstinctMeow Meow MeowIntuitiveThis Old HouseWet BanditLetters to Katie 10 15.42
View unlocking history of this single game only
GoNNER 1.7840341330The floor is lavaCOMBO GODGet off my lawn!GLYPHSImpressive.Good job.Combo bomb 10 12.99 1.7753479481Smooth!HahahaWoah!Stare into the abyssUndeadI can take care of myself.lovelovelove 9 17.34
View unlocking history of this single game only
Graceful Explosion Machine 1.1656538248Catacombyeeee!Scarlet Ep So LongHomeward BoundSnatch Defeat from the Jaws of VictoryNo Flipping ModeS+ is+ for S+upers+tarSnipe, Sniper, Snipest 20 18.57 1.2625638247Perfect Planet∞ goodLet's do the time WARP+ againMaster of the Universe 4 5.65
View unlocking history of this single game only
Greyfox -1 0 0.00 1.0599222183A Dirty JobPickpocket10. Tea BaggedMabelThe NurseMr. BrownThe Kat Lady 16 18.71
View unlocking history of this single game only
Guacamelee! Gold Edition 1.5767244101Bone on boneCatch the Rainbow!They hit really hardGOOOOOOOAL!The Old-Fashioned WayTitle ContenderThe Devil wears Revenge! 58 54.90 1.5568295717World ChampionThat was Hard Mode? 2 3.22
View unlocking history of this single game only
Gun Monkeys -1 0 0.00 0.8358811140Prime MateMonkey FeverStill AliveCheeky MonkeyWinning Streak!CocktailFly, Monkey, Fly! 8 9.25
View unlocking history of this single game only
Gunpoint 0.5752733350Perfect GentlemanI'll Aim When I'm DeadGentlemanSo This Is Why People Don't Like MeDingGhost 6 2.60 0.3845445514Short CircuitCat BurglarOpen Door PolicyI May Be Some TimeRooke SympathiserCover UpBreaking And Entering 36 26.10
View unlocking history of this single game only
Guns of Icarus Alliance -1 0 0.00 0.9840848446Hands OnThe Grand TourLook AliveStop, Drop, and RollBroad Side of a BarnHow Stuff WorksBody Work 849 2244.75
View unlocking history of this single game only
Guns of Icarus Online -1 0 0.00 0.4119073749Hands OnThe Grand TourLook AliveBroad Side of a BarnHow Stuff WorksStop, Drop, and RollBody Work 849 2458.89
View unlocking history of this single game only
Hacknet -1 0 0.00 0.7105575800EntropyCSECMakeover!To the WirePointClickerYou better not have clicked for those...Quickdraw 11 11.75
View unlocking history of this single game only
HackyZack -1 0 0.00 1.5089043379World 1 SquashedSord BearerWorld 2 CrushedIsolationWorld 3 SqueezedWorld 4 TrampledDenial 27 55.55
View unlocking history of this single game only
Halcyon 6: Lightspeed Edition -1 0 0.00 0.8712225556Tier 1 ShipBlanket Fort BaronKnowledge is PowerBeam Us Up, EnsignOne Star ShipCity PlannerTwo Star Ship 71 121.76
View unlocking history of this single game only
Halcyon 6: Starbase Commander (CLASSIC) -1 0 0.00 0.6468876600Tier 1 ShipBlanket Fort BaronKnowledge is PowerBeam Us Up, EnsignOne Star ShipTwo Star ShipBandit Hunter 69 98.39
View unlocking history of this single game only
Hammerwatch 0.7524644732The QueenMass murder 2 1.25 0.5307902098AffluentThe Grisly CombinationThe KnightRichHarvestingThe LichThe Dragon 36 55.87
View unlocking history of this single game only
Heckabomb -1 0 0.00 1.2812374830ROCK ONVOGON CAPTAINABOUT TO ROCKSMALL HAULMINE ALL MINEROOKIE BADGEROCK STEADY 46 81.78
View unlocking history of this single game only
Hektor -1 0 0.00 1.6270318031Sorry I’m late, BossUnderdogThick SkinDown the Rabbit HoleDisobedientA.E.A.God Mode 16 30.49
View unlocking history of this single game only
Hell Yeah! 0.9476749897Good santa!Fashion victim!Pimp that wheel!Armed and dangerous! 4 3.33 0.9997615218Quick rabbitIsland's masterBug tracker!Weapon CollectorGroundhog day lover!Superior Completion Skillz!JACKPOT!! 8 10.69
View unlocking history of this single game only
Hello Neighbor -1 0 0.00 1.4187418222Hmmm BaconUp Up!Get'em GeorgeI Had No Choice!No More FearsTop Of The WorldMeet Joe Black 17 27.05
View unlocking history of this single game only
Her Story -1 0 0.00 0.4836311936It's a happy ending.A Traditional BalladHave you ever eaten fennel?Expressing My IndividualitySpilt CoffeeThe ReflectionRomantic 13 7.77
View unlocking history of this single game only
Hero Academy 1.1393088102Well EquippedBlowing Up in StyleBOOM! Headshot!Cry Some MoreStanding StillThe Best and the BrightestTake All Day Academy 14 11.51 0.9045151472Level the FieldStomp the YardVvvictory!Pocket MedicI'm HookedOld SchoolNice to Beat You 26 33.88
View unlocking history of this single game only
Hero Academy - Dwarves Pack 0.5669175386Shields Up! 1 0.57 0.5062757730Short But FeistyHero, Heal ThyselfClose EnoughMy BoomstickStrangeloveDwarven Hero 6 4.86
View unlocking history of this single game only
Hero Academy - Shaolin Team Pack 0.5828562379Sweep the Leg 1 0.58 0.4851037860Triple ThreatBad DiseaseWe Are OneMine, All MineI Like VanillaSo Many Victories 6 4.81
View unlocking history of this single game only
Hollow Knight 1.2245138884Happy CoupleGrand PerformanceFoolMaskedSolaceBlessedStrength 35 24.57 0.7350226045RivalryWitnessVoidMortalityAscensionPurityDark Romance 28 35.99
View unlocking history of this single game only
Homefront -1 0 0.00 0.5141638517ChroniclerWhy We FightFreedomFire SaleThe WallHeartlandOverwatch 47 59.25
View unlocking history of this single game only
Horizon Shift -1 0 0.00 1.2006648779That's a Good StartOne DownBoom!Big Boom!1UpHorizon HeroFlawless Victory 12 22.59
View unlocking history of this single game only
Humanity Asset -1 0 0.00 1.3226654530Training1MaxMission0BomberTraining2BigbossMaxMission1Gunkeeper2 38 74.58
View unlocking history of this single game only
The Huntsman: Winter's Curse 1.3711404800Lost BrothersGeorge's Cloak 2 2.49 1.8927400112The SanctuaryA New MemberMagic's WebThe Mountain's SecretThe Enchantress' PowerYou've Got A BoatInner Battle 8 15.65
View unlocking history of this single game only
Hyper Light Drifter 1.4228472710Natural LeaderArmoryDiamonds Are ForeverThe Dash EternalStar AthleteMeditationNothing's Easy, Now is it? 10 10.28 1.0824353695BullyLine Em' UpLibrarianBoss Rush Level 1ContenderWalk-In ClosetShine Bright 13 21.65
View unlocking history of this single game only
Iconoclasts 0.5429194570Life ExperiencePitch BlackPearly GatesColoring AgentFeature CreepParrying Mechanic 6 2.37 0.9217854738PsychopompsMelodramaBeaucoup BootyMultitoolOne-Hit Wonder 5 5.34
View unlocking history of this single game only
Insanely Twisted Shadow Planet -1 0 0.00 0.9932267666Complete HomeworldComplete OrganicComplete OceanComplete IceComplete MechanicalComplete ElectricalComplete Game 17 31.48
View unlocking history of this single game only
INTERSHELTER -1 0 0.00 1.2567187548First blood69PunisherSurvivorHeadacheKillerButcher 12 19.36
View unlocking history of this single game only
Into the Breach 1.0510895252ChronophobiaHard VictoryTrick ShotUnbreakableEngineering DropoutDistant FriendsTrusted Equipment 42 25.65 0.7122687697There is No TryHold the LineGlittering C-BeamOverkillLightning WarMech SpecialistChange the Odds 13 12.31
View unlocking history of this single game only
Invisible, Inc. 1.8877916336Meta-HackingAnt SocietyMeat MachineTraining WheelsTarget ResolvedNearing Confidence ThresholdGhost Moves 9 8.83 1.3559700251Fully EquippedThe LimitInvisible Inc.Powerful ToastDaemon CodeRebuilding the FirmNever Look Back 14 27.79
View unlocking history of this single game only
Jack Lumber 1.6685773134All that GlittersQuintpicsSplinter SellMore like "Threebeard"Silver Bells... er SashesPerfected the peaksTurns green when wet. Or is that copper? 20 27.18 1.5749630928You're doing it wrongSyrup SycophantWe're going to need a bigger razorSap-o-holicDaddy WarlogsFinish your errands, Jack!Plaidtastic 7 12.00
View unlocking history of this single game only
Jet Set Radio 0.7810085416We got us a crewFeel the Beat 2 1.43 0.9888181090I Need a ParachutePublic MenaceLook BehindRemixes Suck!Unlock GaramFirst Coat AppliedSecond Coat Applied 28 52.07
View unlocking history of this single game only
Jettomero 0.5911264420Forest RangerLunar StandingStorm ChaserToo Hot to HandleFinding A Purpose 5 2.32 0.4846711457Rubble RescueA History RevealedTo be or not to beFinally a HeroAssisted TakeoffComet HunterAccessory Master 10 7.19
View unlocking history of this single game only
Jotun: Valhalla Edition -1 0 0.00 1.0197069645Tame the WildsDefeat the DarknessConquer the ColdShun the Gods - JeraWeather the StormBrave the InfernoValhalla Awaits 36 65.65
View unlocking history of this single game only
Juicy Realm 0.9133457541No Sweet Tooth!Wild WestPear PunisherDog Don't BiteMini Mistake 5 3.10 0.9925270081Spider or Crab?First JuiceDeathly DesiresApple AnnihilatorMelon KillerBotanistOne-Punch Girl 31 44.67
View unlocking history of this single game only
Just Shapes & Beats 0.5864747763Hits after HitsChillBeatboxPretty goooood!It's Over, for real, reallyIt's Over, for realIt's trying to say something 11 3.73 0.5248178840SkillsFreestyleLow FivesBreakcoreHendrix LevelLearning itGreatest Hits 15 13.22
View unlocking history of this single game only
Kathy Rain -1 0 0.00 1.1074326038ProcrastinatorMr. Bear, reporting for duty!Get on the KatmobileHotwheelsWow, they're hypnotic...We've met before, haven't we?Down the rabbit hole 20 23.94
View unlocking history of this single game only
Keep Talking and Nobody Explodes 0.7789862156All in ModerationTrust the ExpertExperience is the Best TeacherBomb Defusing 101Action Hero 5 2.69 0.9458613396MultitaskerChallenge AcceptedTo the Extreme!Seasoned TravellerBomb Squad 5 7.87
View unlocking history of this single game only
Killer is Dead -1 0 0.00 0.5327739120Kidnapper ExecutedToast to ForerunnerAlice in Dead LandSuck Like a LeechHave You Got Clean Hands?9 to 1 on GoliathHad a Bad Dream 48 63.29
View unlocking history of this single game only
Killing Floor -1 0 0.00 0.1766404659ExperimenticenticideIt's Not Easy Being GreasySocial OutburstExperimentimillicideStraight RushA Bloody Christmas CarolPhilanthropist 285 339.04
View unlocking history of this single game only
Killing Floor Mod: Defence Alliance 2 -1 0 0.00 2.4924376011Lucky damageClot ChampionSetup the defenceBloat ChampionGorefast ChampionAlliance 1 - 0 ZombiesYou're a teamplayer 30 76.16
View unlocking history of this single game only
King Arthur's Gold -1 0 0.00 1.2874014378Brave new worldWinnerYou can talk!Braver newer worldRoger the ShrubberWHAT... is your favourite colour?Just a flesh wound 64 147.79
View unlocking history of this single game only
King's Guard TD -1 0 0.00 1.0678669214Arrow TowersBloodMytinaWarriors DownLegacyDestructionDragon Killer 10 14.84
View unlocking history of this single game only
Kingdom: Classic 1.5544918776The Tenth Day We Fought BackOn the Third Day I Lit a FireOn the First Day I Built an ArmyBy Day Six I Was RichDay XXVDay XXDay XV 9 9.63 0.9904049039Day XXXDay XXXVDay XLDay XLVDay LBy the Seventh Day I Cleared an AcreOn the Second Day I Got a Gift 25 37.38
View unlocking history of this single game only
Kingdom: New Lands 0.8750398159By the Sixth Day I Was Rich.Birth of a ReignDay XVDay XDay V 5 3.50 0.7957628965Day XXOn the First Day I Built an Army.Day XXVOn the Second Day I Got a Gift.By the Seventh Day I Cleared an Acre.Day XXXOn The Tenth Day We Fought Back! 29 41.66
View unlocking history of this single game only
Knights of Pen and Paper +1 0.6722694635Say Hi to the Game Devs!Hit That VeinBlacksmith Level Up!Tough Battle!UnluckyLuckyLevel 5 8 4.44 0.7709801197Level 15Class: BarbarianClass: BardWhat a Waste!Class: HunterGrindstone MasterDungeon Cleared 34 37.99
View unlocking history of this single game only
Labyronia RPG -1 0 0.00 1.0243330002Welcome to the World!Unknown ExplorerNo LoveDragon SlayerGuardian of the ElementsMonster Mash 6 8.09
View unlocking history of this single game only
Labyronia RPG 2 -1 0 0.00 1.4917076826Windir!Cold as IceBorder CrossingMr. PopularCrumbled Cave FightThe Beginning of the End 6 9.39
View unlocking history of this single game only
Layers of Fear -1 0 0.00 0.7552707791It's covered up for a reasonIt rings a bellWandererScraps of loveThe artist's impressionInspired OCDArtist's struggle 18 21.22
View unlocking history of this single game only
Legend of Dungeon 1.2591218948Hot Foot 1 1.26 1.1087567806Bar BrawlPETAAlcoholismWeak BladderHero!Boss SlayerNot Afraid of the Dark 15 37.82
View unlocking history of this single game only
The Legend of Heroes: Trails of Cold Steel 0.6390764713Breakout PerformanceFollow-Up MasterEightfold ObliterationA Midsummer's RevelsMaking the GradeBeyond the RailwaysThe Verdant City 12 5.60 0.5341123343Flawless JewelLink MasterSigns and OmensProgressive ChaosPut to the TestAdvanced BeatonomicsThe Cutting Edge 39 33.65
View unlocking history of this single game only
The Legend of Heroes: Trails of Cold Steel II 0.6900517941Double the TroubleMind if I Cut In?Aboard the PantagruelStar PupilAshen ChroniclesTacticianPieces of Eight 10 4.47 0.4846711457Transcendent JewelInseparableThe Awakening LionsForging the FutureOne Good Burn Deserves AnotherForward, RelentlesslySmells Like Team Spirit 41 31.28
View unlocking history of this single game only
Legend of Mysteria -1 0 0.00 1.3659549952Its A Break Out!Sneaky SneakyA Loyal AllyDjinni The Magic DragonA Portal To LabyroniaAll In A Days Work 6 8.74
View unlocking history of this single game only
Lethal League 1.0213679075Mass KO ProductionLethal RivalsDouble PlayBats In The DarkRifle Strike 5 3.04 0.5539042950Chrono WarpClutchRookie PlayerChrono Warp ClusterOld SchoolGrand SlamAce Player 18 25.61
View unlocking history of this single game only
LIMBO -1 0 0.00 0.4541023970Altitude is AttitudeWrong WayWhere Credit is DueAlone in the DarkBacktrackingUrban ExplorationGuided by Sparks 13 11.70
View unlocking history of this single game only
The Lion's Song 1.1472319365A joke among friendsAll the praiseWho are you?Who needs sleep?A love songA letter from GreteSilence 10 9.87 0.9709768295The first threeMy familySuccess?A symmetry withinMy name?For the musicNo time to talk 10 12.74
View unlocking history of this single game only
Loot Hero DX -1 0 0.00 0.6966333389Loot HeroKnightJust StartingSeriousMaster LooterOverpoweredGrinder 20 15.89
View unlocking history of this single game only
Loot Rascals 1.2287920713Start Of The CenturyHow Did You Manage To Get Inside My Head?Better To Be Busy Than Bored 3 3.38 1.5706946850Funny TimesI'll Never Be The SameWatch Your StepEverything's OddI'm Waiting For YouI Killed The NeighboursBomb Bomb Bomb Bomb 19 47.82
View unlocking history of this single game only
Lovely Planet -1 0 0.00 0.9230171442True SamuraiHarakiriAce CityHungry SamuraiGravesAce VillagePearl Dagger 14 21.19
View unlocking history of this single game only
Lovers in a Dangerous Spacetime 1.2444075346Belt It OutCouples Dance LessonsDressed to the NinesSpace-man's Best FriendClearing the AirWave GoodbyeBear-Knuckle Boxing 11 10.09 1.1686388254CootiesRocket ScienceLove Has PrevailedWarm EmbraceOverprotectiveExposedMissile Kiss 17 30.31
View unlocking history of this single game only
Lucius -1 0 0.00 0.4788497388First bloodDouble murderThere is no answerGetting the hang of itWe got ourselves a readerSerial killerAre You There God? It's Me, Lucius 58 55.26
View unlocking history of this single game only
LUFTRAUSERS 0.8546780944DONT MESS WITH THE RAUSERWHAT DOES SFMT STAND FOR?EXPERT RAUSERYOU WERE RAISEDSERIOUSLY, DONT MESS WITH THE RAUSERBIG SCIENCEUNDERWATER SUPERIORITY 10 6.17 1.6335264444SEEN IT ALLMASTER RAUSER 2 3.36
View unlocking history of this single game only
LUMINES REMASTERED 0.9674426913SprinterWorld in Slowmo180sec Challenge300sec ChallengeCombo PerformerGalaxy Wars60sec Challenge 13 6.68 0.6948080659Agent TraineeDJ PlayerLights!Charismatic DJVeteran AgentSpeed RunMission Accomplisher 17 20.12
View unlocking history of this single game only
Magicka -1 0 0.00 0.1397297084State AlchemistBasic ElementCooking by the bookAn eye for an eyeNo more trollingLet off some steamHoudini 52 38.66
View unlocking history of this single game only
Megabyte Punch -1 0 0.00 1.0346957445Bouldar down!100 Enemies downGeneral defeat!No more Grand Khotep...500 Enemies downSubprogrammed!I believe I can jump 30 53.29
View unlocking history of this single game only
Melissa K. and the Heart of Gold Collector's Edition -1 0 0.00 1.2603152990Been there, done that, got the T-RexInventory KingMay I Hint You?Gecko Says NoI Gotta Pea!Cruise ControlFearless 26 40.74
View unlocking history of this single game only
Mercenary Kings 1.0238590240Untouchable 1 1.02 0.8338611722ExecutionerDenied!HoarderBaron BashingFavoritePoacherIs That A Knife? 25 44.61
View unlocking history of this single game only
Merchants of Kaidan -1 0 0.00 1.6456730366Double moneyReal moneyJinxLuckyGadgeteerMonster SlayerCareless 22 42.90
View unlocking history of this single game only
METAL SLUG DEFENSE 1.0387001038Area 2: Free "TARMICLE ROVING Ⅲ"!Area 1: Free "MARCHRIUS DENNIS ROSSI"!Area 2: "EAST ASIA" conqueredArea 1: "SOUTHEAST ASIA" conquered 4 3.54 0.9516402483Area 3: "AFRICA" conqueredArea 4: "CENTRAL ASIA" conqueredArea 5: "DR MOUREAU'S ISLAND" conqueredArea 6: "OCEANIA" conqueredArea 3: Free "FIOLINA GERMI"!Area 7: "NORTH AMERICA SOUTH" conqueredArea 4: Free "ERI KASAMOTO"! 60 73.86
View unlocking history of this single game only
Mighty Gunvolt 1.1275084019A Peaceful ApproachStockpilerShot to the HeartBlue ButterflyMaster of LightningOld-School CoolSuper Combo 8 7.32 1.0558866262Master of LoveMaster of MightPerfectionUnscathed Hero 4 4.65
View unlocking history of this single game only
Millennium - A New Hope -1 0 0.00 1.0422401428CuriosityGettin' On With the JobEverybody Has To StartFairy WhisperDiscovering MystThe First StepThe Examiner 52 89.48
View unlocking history of this single game only
Mind Spheres -1 0 0.00 0.99239414935 Puzzles!Released Energy.15 Puzzles!The Mind Gears25 Puzzles!Taste of Space35 Puzzles! 11 11.95
View unlocking history of this single game only
Mini Metro 1.0586190224Thames TunnelHopركابBilhete ÚnicoOPUSПодорожникDay trip 14 9.42 1.0593677759ClipperCity of LinesT-moneyHook Turn交通一卡通SmarTripEarl Grey 35 60.28
View unlocking history of this single game only
Minion Masters -1 0 0.00 1.0693069696Ranked WinnerChallenge accepted!Apprentice CollectionThe Stone LeagueSupreme!Ranked ConquerorChallenge completed! 38 52.66
View unlocking history of this single game only
Minit 0.9502363205BEST FRIENDDOG WASHERWORLD TRAVELERMINITSAFETY INSPECTORGHOST HUNTERCONNOISSEUR 17 13.17 0.9849984050PUNCTUALMARINE BIOLOGISTARCHEOLOGISTCOLLECTORTREASURE HOARDERFULL AIDERHI MY NAME IS MARY 10 11.74
View unlocking history of this single game only
MOBIUS FINAL FANTASY 0.6710306406Welcome to the MOBIUS FINAL FANTASY!! 1 0.67 0.7803560495Chapter One Cleared!Chapter Two Cleared!Chapter Three, Part One Clear!Chapter One Complete!Exploration One Clear!Chapter Three, Part Two Clear!Chapter Four, Prologue Clear! 34 42.46
View unlocking history of this single game only
Momodora: Reverie Under the Moonlight 1.5181523561PacifistImperishableBug CollectorExplorerHealthy!FaithfulP-pleasegiveittome! 8 9.47 1.5854139328Don't even try this. 1 1.59
View unlocking history of this single game only
Monaco 1.2814567089Technician 1 1.28 0.5612261891MassacreDem BonesWhackedSlipperySilent WithdrawalI Work AloneIdentified 12 18.84
View unlocking history of this single game only
Monolith 1.0524533987Tag ChampionThorough ExplorerForbiddenMaster of the UnseenAccursed OneAnnoyingEnd Layer 11 5.63 0.9043909311Ego Sum AeternaeSpeed RunnerTreasure TroveToo RefinedThose You Could SaveIntenseFreedom 31 29.92
View unlocking history of this single game only
Moon Hunters 1.4983386993LoremasterAncestral InsightAncestral CourageAncestral GraceA New AgeBetrayalAncestral Strength 13 13.53 0.9668833613Intrepid ExplorerDancerPazuza the Wind SpiritChilledAncestral ArtistryAncestral SongHildisvini 34 55.20
View unlocking history of this single game only
Moonlighter 1.5223144293Balanced WarriorSlime Protection ServiceGolem ApasionateScribeDecorative MindArcheologistRage against the Golems 34 30.68 0.9505870938Special PlaceGotta go fast!Rage against the ForestHeavy WarriorForest ApasionateDistant WarriorBerserk Warrior 33 64.29
View unlocking history of this single game only
Morphopolis -1 0 0.00 0.6875781417Seed SwapAphidoideaStigma TubesGlow WormsGrylloideaBettle PairingApoidea 13 10.30
View unlocking history of this single game only
Moto Racer 4 -1 0 0.00 0.9664207697RookieAttack of the plumberMom! Look at me!WhiplashOléTo infinity and beyondStart with Style 50 84.33
View unlocking history of this single game only
Mr Shifty -1 0 0.00 0.9513978362Yippee ki yaySurprise!Traitor1000 fistsBody Count RecordCapturedCatch! 14 19.29
View unlocking history of this single game only
The Mummy Demastered 0.6573427320Defy Human AbilityMonster BashThe Ultimate EvilSeker SeekerHunt MonstersHeavy DutyEscape the Watery Grave 29 12.49 0.5867616534Crush the DarknessEradicate EvilProdigium ProtectionThat Was IntenseStand your GroundWorld of Gods and MonstersUndead Agent 8 6.23
View unlocking history of this single game only
Nebula Online -1 0 0.00 1.8164590597Работоспособность двигателейNebula’s minerConstructorTechsmithPirate’s destroyerLlerey’s destroyerThrough asteroids and fragments 27 60.88
View unlocking history of this single game only
Necropolis 0.3499131799LibrarianPower SlayerAdventurous EaterCraftspersonWelcome to the Necropolis 5 1.24 0.2902103066Suit UpIntrepid AdventurerMisadventurerTrue AdventurerSneaky, SneakyEpic MiserMaster Librarian 8 8.36
View unlocking history of this single game only
Neon Chrome -1 0 0.00 0.8863824010SpiderbotHard WorkCentipedeHovertankOverseerGritExplosive 14 21.68
View unlocking history of this single game only
NEXT JUMP: Shmup Tactics -1 0 0.00 1.5551840067RookieAnother one bites the space dustYou know the sayingFireworksIs it New Year already?Wasn't me at the bar!The Dagger 51 91.59
View unlocking history of this single game only
NiGHTS into Dreams... 1.4779019356the POSSIBILITYthe AFFECTIONthe IDEAL 3 4.07 1.4040626287Hello Mepianthe CONSCIOUSNESSthe CONFUSIONthe REVIVALMystic Garagethe GROWTHMerry Christmas! 10 17.78
View unlocking history of this single game only
Ninja Senki DX -1 0 0.00 1.3474675417Kick Down the Door!Sure You Can!Flawless RevengeTanuki SoupPath to RevengeYokai BusterMusashi 26 42.21
View unlocking history of this single game only
Nova-111 2.2522628307Laser Master 3000To the PointSpeed RacerEnemy Infighting 4 7.12 1.5993208885Bomb DiggityWall GrinderBrojectileImmortal TechniqueStop, Hammer Time!Science, Yo! 6 13.70
View unlocking history of this single game only
Nuclear Throne 0.9994875789MMMMMMHMMM!Horror UnlockedGood FindSteroids UnlockedY.V. UnlockedHunter KillerSincere Apologies. 13 8.54 1.0181493759Chicken UnlockedRogue UnlockedThrone SitterRebel UnlockedThe Struggle ContinuesAdvanced SitterCrystal Can Shield 31 48.94
View unlocking history of this single game only
Oceanhorn: Monster of Uncharted Seas 1.2723373175CosmopolitanCatch FirebackCatch Arcadian PikeWizardShish KebabHey, Big Spender!Blast'em! 45 40.82 1.1407983303Train WreckEncyclopedia MonstrumKnight of ArcadiaUnspawnStill GoingMasterOld Enemy 18 22.81
View unlocking history of this single game only
Odallus: The Dark Call 1.5283064842Pieces of HeartGhost KnightSilver ClaymoreUnforeseen ConsequencesFrozen MinesAqueducts Area-2Explorer 17 22.91 1.4209122658Steel Claymore"There can be only one!"Weapon BagsQuickeningWHAT ARYO BOOYIN'?NoblemanI want to believe 12 23.34
View unlocking history of this single game only
Odysseus Kosmos and his Robot Quest - Episode 1 -1 0 0.00 1.5202183723Rifle on the wallKitty kitty, JoneseyE1 - done!EliteMusophobiaSave the Photons!Taking Care of Fellow Earthlings 24 42.94
View unlocking history of this single game only
OlliOlli -1 0 0.00 1.0519191027CombododragonDizzyLocked OnLand LoverMake your MarkHalf Way ThereSo Many Points 12 22.94
View unlocking history of this single game only
Omega Strike 0.9088914394A Feast To Die ForHard HatCrazy ApeTreasure HunterLife ExtendedDrill No MoreTaste's Like Chicken 16 10.39 0.8650811911SoldierDisposedWings ClippedDethronedIntruderChampionLoot Hoarder 8 7.77
View unlocking history of this single game only
Oniken 0.9855507612Self ReferenceFirst Blood 2 1.60 0.8275027871CarnageEscape from L... the baseMost DangerousProto ThunderNo Death 1BattleshipIce Climber 30 51.36
View unlocking history of this single game only
Orbt XL 0.7138134837BorgishSunish50 PointsNeptunishUranusishSaturnishJupiterish 20 12.11 0.706667125255 PointsNear Missed!Dogeish60 PointsPixelishBlackholeish65 Points 11 8.26
View unlocking history of this single game only
Ori and the Blind Forest 1.2431761026Master of the ForestDeadly DashBash MasterPowerhouseMaster GuardianPhenomJuggle Master 45 30.01 0.7136020064AirborneNo Stone UnturnedSupersonicEliteImmortal 5 6.91
View unlocking history of this single game only
Out There Somewhere 1.3059127331Infinite runnerSwift successPermission deniedNever give upAround the worldHuge SuccessTelejump Mania 16 16.90 0.9843339324..Thanks?Teleport machine gunThis is pointlessMirror mirrorRasputinFifth ElementAll your base are belong to us 20 26.55
View unlocking history of this single game only
Outland 1.4653036594Environmental ExterminatorEnthusiast 2 2.84 1.1814078093That’s TeamworkDon’t Go AloneGrand MasterTwo BirdsOverkillUntouchableSurvivor 10 16.63
View unlocking history of this single game only
Outlast -1 0 0.00 0.7342345715ILLUMINATEDFLUSHEDSOAKEDEMANCIPATEDPUNISHEDEDUCATEDPULITZER 8 8.73
View unlocking history of this single game only
Outlast: Whistleblower DLC -1 0 0.00 0.8623592854GAS LEAKERSHOCKERWHISTLEBLOWERARCHIVISTLEGACYBOWELWHISTLER 6 6.73
View unlocking history of this single game only
Overcooked 0.9744514823Closest FriendsDoes not play well with othersBest Served ColdMeals on WheelsOvercookedThe Pieces I Ate (sorry)Lettuce Begin 7 4.08 0.7369770408Kitchen NightmaresOut of this worldChef FlambeHero of ThymeAll the Trimmings 5 4.99
View unlocking history of this single game only
OVERWHELM 0.9757468104FULL POWEROVERWHELMHALFWAYDARKSTEALTHWETROCK 9 6.11 1.8208448887NEW GAME+ 1 1.82
View unlocking history of this single game only
Owlboy 1.4091207981Trinket Grand MasterTrinket MasterTreasure SeekerReminiscingGood boyFlight of the BoguinMusic Master 9 10.76 1.2742459774Ancient MemoriesOops...Treasure Seeker Grand Master 3 3.99
View unlocking history of this single game only
Pan-Pan 0.8715096712Brute forceHoarderFriendCONGLATURATION !!!Fellow traveler?ExplorerFinder 12 8.75 1.0660843849Foe 1 1.07
View unlocking history of this single game only
Papers, Please -1 0 0.00 0.3824951947Obristan TokenAntegria TokenArstotzka TokenToo HonestImpor TokenHired RifleKolechia Token 13 11.23
View unlocking history of this single game only
Paranautical Activity: Deluxe Atonement Edition -1 0 0.00 0.7942076325Good StartChosen OnePaddedProgressTyrusUnsure FootingNazi Hell 45 92.80
View unlocking history of this single game only
PAYDAY 2 -1 0 0.00 0.1034277007No One Cared Who I Was...No Turning BackHow Do You Like Me Now?You Gotta Start SomewhereTip the ScalesGuilty of CrimeWould You Like Your Receipt? 669 952.83
View unlocking history of this single game only
Phantom Trigger -1 0 0.00 2.0272891521It's All Your FaultWeapon MasterHelping HandBrainiacI'm All AloneNew AdventurateInsanity from the beginning 16 37.79
View unlocking history of this single game only
Pharaoh Rebirth+ 1.3992409706Free-fall MasterFighterStealth StepExtra Stage ClearAnubis30 AerialGame Clear 24 16.60 1.2308365107Rank SRank ACollectorRank BCar GOCar Expert 6 8.34
View unlocking history of this single game only
Pid -1 0 0.00 0.6082962155The first memoryYoung CartographerBothersome guestJunior ExplorerLittle guestGoodbye little guestSenior Explorer 12 20.51
View unlocking history of this single game only
Pix the Cat -1 0 0.00 1.2901158333PERFECTAMUNDOTOP 100 GANG!TOP 10 CREW!I GOT A FEVERB&W PRINCEFOCUS... STEADY...B&W KING 11 23.15
View unlocking history of this single game only
Pixel Puzzles 2: Anime -1 0 0.00 0.6715114117Puzzle 1 CompletePuzzle 4 CompletePuzzle 3 CompleteDL-TV Puzzle CompletePuzzle 8 CompletePuzzle 18 CompletePuzzle 11 Complete 27 23.98
View unlocking history of this single game only
Pixel Puzzles Ultimate -1 0 0.00 0.9048406482Lets Get PuzzlingTutorial Complete!Puzzling Begins Here!1st Puzzle Complete!100 PIECES PLACED!Zen PuzzlerGotcha! 352 699.70
View unlocking history of this single game only
Pixel Puzzles: UndeadZ -1 0 0.00 0.7639856339Puzzle 1 CompleteChomp ChompNade ThrowerPuzzle 2 CompletePuzzle 3 CompletePuzzle 4 CompletePuzzle 5 Complete 34 32.78
View unlocking history of this single game only
PixelJunk Eden 2.0022859573Garden 10: CompleteGarden 07: CompleteAll Gardens Clear (Garden 01 - 10)Garden 06: CompleteThirtysomethingGarden 05: CompleteFifteen Crystals 26 32.90 1.5601016283All Seeds 03All Seeds 05All Seeds 04Prowler Mach 500Bank ShotAll Seeds 06Zero-G 35 73.49
View unlocking history of this single game only
Planet Ancyra Chronicles -1 0 0.00 1.5869644880I met Mr.HartI met Mr.VaughnI met an EngineerI met a crateI met a forestI met Ms.AlixI met Mr.Bernard 28 52.43
View unlocking history of this single game only
Planet Diver 1.8653371334Centauri ExpertSuit ShopperCentauri RegularCentauri ExplorerCentauri HeroCentauri HobbyistCentauri Novice 9 14.56 1.7447631359Big Game HunterBuddy TinkererCentauri VeteranCalypso NewbieCalypso NoviceCentauri JockCalypso Star 43 101.60
View unlocking history of this single game only
Poly Bridge 0.3462905288Tutorial Completed 1 0.35 0.6598113775Completed Alpine MeadowsCompleted Alpine Meadows Under BudgetCompleted Alpine Meadows Under Budget and Under 100% StressCompleted Desert WindsCompleted Desert Winds Under BudgetCompleted Desert Winds Under Budget and Under 100% StressCompleted Ancient Ruins 21 36.40
View unlocking history of this single game only
Prismata -1 0 0.00 1.4755283594Outbreak CompleteOptimal BlockingDefenderSuper SpectatorSo Much DefenseBeginner Scenarios CompleteStream In My Sights 114 197.18
View unlocking history of this single game only
Psychonauts -1 0 0.00 0.5960561037Your Last Chance to Chicken OutA Victory for Good TasteJunior PSI CadetRolling Rock StarFor Insurance ReasonsRegular PSI CadetHoliday Dinner 37 44.40
View unlocking history of this single game only
Punch Club 0.4356449842Prevention of a crimePizza eaterMeet CaseyMeet ApuMeet SilverMeet MickFirst fight 7 2.61 0.4474854171Meet TylerA friendUltimate fightsTraining resultsTake the challengeSpicy pizza5th Place 40