]> Achievement Stats » Profiller » TheDavixZ80

TheDavixZ80

Tamamlanma ilerlemesi
Yükleniyor...
Sıralama 94550
Başarım 2118 (1407,98 puan)
Oyun ve DLC sayısı 366
Sahip olunan tüm oyunlar 523
Rozetler 60 (16691 XP)
Üyelik tarihi 01 Ocak 2014
Toplam oynama süresi 8836,1 saat
Tamamlanma oranı % 9,5
Konum Colombia

Özeti göster/gizle

Başarım

Oyun # Açılmış başarımlar Kilitli başarımlar
Şimdiki en iyi # Puan % Sonraki en kolay # Puan %
100% Orange Juice 109 -1 0 0,00 0 0.6376780868Not Playing with a Full Deck of CardsPacifistBanned for LifeUnstoppableYou Can Run...Full Metal BrotherNice Present 109 200,50 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
[NINJA GAIDEN: Master Collection] NINJA GAIDEN 3: Razor's Edge 48 -1 0 0,00 0 0.6244035363Obliteration TechniqueSteel on BoneUltimate TechniqueNinpo MasterThe Grip of MurderBumpy RideIzuna Drop 48 63,71 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
[NINJA GAIDEN: Master Collection] NINJA GAIDEN Σ 51 0.3263810575Cleared The Way of the Ninja 1 0,33 2 0.4584182501Rookie Scarab HunterNinja CarnageCleared The Fiend HunterLead Scarab HunterCleared Tairon Under AlertMaster Scarab HunterProjectile Weapons Master 50 66,15 98
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
[NINJA GAIDEN: Master Collection] NINJA GAIDEN Σ2 41 -1 0 0,00 0 0.5879860520Learned the Reverse WindLearned the Shadowless FootstepsLearned the Art of the InfernoLearned the Obliteration TechniqueLearned the Flying Bird FlipLearned the Flying SwallowLearned the Ultimate Technique 41 46,24 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
A Bird Story 1 -1 0 0,00 0 0.4861112833Tomorrow 1 0,49 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
A grande bagunça espacial - The big space mess 100 -1 0 0,00 0 1.2074881792Terminator of the pastTerminator of the presentMockinator of the futureBullseye!Got wasted here 1Full bullseye!!!Bullet saver!!! 100 195,19 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
A-Gents 17 -1 0 0,00 0 0.9856175780First BloodButcherBombermanSpin doctorA-GentSanta's helperWild cat 17 28,18 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Acceleration of SUGURI 2 24 -1 0 0,00 0 1.7710443735Keeping It CoolCombo MasterShield Breaker1CCRoad of ChampionsGoing FasterBlue Skies 24 47,33 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Adventures of Shuggy 13 -1 0 0,00 0 0.6847955585Master Of TimeShmu HerderDungeon PerfectionistBoiler Room PerfectionistNinjaCastle ReclaimedGallery Perfectionist 13 16,86 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Aegis Defenders 31 -1 0 0,00 0 0.9796561003Hungry HunterGrandpa to the RescueAmateur HunterRuinhunter-in-TrainingDiscovered AegisExpert HunterActivated Aegis 31 55,98 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Afterfall InSanity Extended Edition 44 -1 0 0,00 0 0.7493560314ParasomniaJackpot!PsychosisDepressionHere's Albert!ManiaAgoraphobia 44 74,94 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Age of Empires II (2013) 196 1.6853735447Defender of the BritonsRandom Civilization One Hundred VictoriesConverting the WorldOne Thousand CastlesConqueror of the BritonsChampion of the MongolsNo Stone Left Standing 93 92,12 47,4 1.1296330690A Taste of HistoryKing of the HillRising StarThe QuickeningPeaceful BuilderEnemy of the ByzantinesTwenty Scenarios 103 177,35 52,6
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Age of Empires II (2013): Rise of the Rajas 29 0.2220709324Foe of the BurmeseFoe of the KhmerFoe of the VietnameseFoe of the Malay 4 0,82 13,8 0.7822254300Enemy of the MalayEnemy of the KhmerGadjah Mada Campaign CompletedSuryavarman Campaign CompletedEnemy of the BurmeseEnemy of the VietnameseLe Loi Campaign Completed 25 23,38 86,2
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Age of Empires II (2013): The African Kingdoms 31 0.9839793444Master of the African KingdomChampion of the BerbersChampion of the PortugueseYodit Campaign CompletedEnemy of the MaliansFrancisco de Almeida Campaign CompletedSundjata Campaign Completed 14 10,03 45,2 0.8508846164Conquerors Campaign CompletedEnemy of the BerbersEnemy of the PortugueseChampion of the EthiopiansChampion of the MaliansConqueror of the BerbersConqueror of the Ethiopians 17 17,74 54,8
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Age of Empires II (2013): The Forgotten 38 0.6399816275Foe of the IndiansFoe of the IncasFoe of the MagyarsFoe of the SlavsFoe of the Italians 5 3,13 13,2 1.2552229166Alaric Campaign CompletedEnemy of the ItaliansEnemy of the IncasDracula Campaign CompletedEnemy of the IndiansBari Campaign CompletedEnemy of the Slavs 33 49,42 86,8
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Age of Empires II: Definitive Edition 139 1.6486561298Truly Countless BodiesI Was in China BeforeThe Go-GetterNo Wonder on my WatchOffense Is the Best DefenseThe Kushluk AssassinationThe Missionary 73 68,23 52,5 0.5314499736The Wonder, the Wonder, Noooooo...Easy GoingGuardian of ScotlandThe King Is Dead, Long Live the King!HomelessHowdy NeighborToo Lame To Tame 66 93,66 47,5
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Age of Empires II: Definitive Edition - Lords of the West 16 0.5117636323Tour d'ItalieSicilian VictoryBurgundian Victory 3 1,47 18,8 0.6968512535Golden SpursThe English JustinianThe Good, the Bold, and the FearlessHaute CultureUnchivalrous PragmatistThrone ThiefHaute, Haute, brief candle! 13 12,20 81,3
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Age of Wonders III 74 -1 0 0,00 0 0.7157036662First BloodAdventurerSettling DownSiege MasterSeaworthyCasterTreasure Raider 74 125,19 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Agent Awesome 39 -1 0 0,00 0 1.0575538874Intelligent Life DetectedBig SpenderTottally not racism.Guns don´t kill people ISeriously?Guns don´t kill people IINo more TPS Reports 39 66,46 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
AI War: Fleet Command 322 -1 0 0,00 0 0.95328843591. Rainy Day Savings: 50,000 Energy5. Maxed Out Resources1. Warmup: 1 Hour Campaign1. Future Proofing: 150,000 EnergyHeat Wave Brown Out1. Control 2In The Midst Of A Cold, Dark Winter 322 725,98 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Aimlabs 100 -1 0 0,00 0 0.1081647798Early Access UserFounderSpidershot NoobMicroshot NoobStrafetrack NoobDecisionshot NoobSpidershot Rookie 100 136,62 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Airscape: The Fall of Gravity 23 -1 0 0,00 0 0.9075462818UnlocktopusOctopiPickled CalimariOctopodesFried TentacleAn Octopus with a PorpoiseSherlocktopus 23 35,75 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Airstrike HD 12 -1 0 0,00 0 0.9935421348SurpriseStargazerMechanicCombat flightMassive TargetSniperPresent box 12 16,54 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Akuatica 11 -1 0 0,00 0 1.7734391689Into the unknown.Two birds with one stun.Catch me if you can.New challenger.Horror of the deep.I eat babiesNaga. 11 23,60 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Alan Wake 67 -1 0 0,00 0 0.2509766817Follow the LightLet There Be LightFloat Like a ButterflyNordic WalkingBright Falls' FinestUnder a Thin Layer of SkinPaging Mr. Wake 67 59,83 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Alien: Isolation 50 -1 0 0,00 0 0.2402952909A Record of DisasterAwakeThe MissingBuild to SurviveWelcome to SevastopolA Perfect OrganismA Hunt Begins 50 39,59 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Alter World 12 -1 0 0,00 0 1.2872915268Complete 10 LevelsRead the Credits!Die 100 TimesSwitch World 500 timesComplete 20 LevelsComplete 30 LevelsJump 1000 Times 12 17,95 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Amnesia: The Dark Descent 18 -1 0 0,00 0 1.1087878942NOPEAlchemistEscape ArtistDescendantPipeworkerRestorerSurvivor 18 28,86 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Ampu-Tea 11 -1 0 0,00 0 0.5409151912Getting Thirsty...Smashing!You broke it, you pay for it!Flipping the tableKeep Calm, Make TeaRAGE QUITJust a spoonful of sugar... 11 9,24 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Anomaly Korea 35 -1 0 0,00 0 1.0813339949ThreatCollectorTop GearWar MongerMy Private ArsenalPocket changeFire away! 35 59,41 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Anomaly Warzone Earth 42 -1 0 0,00 0 0.4409324527RepairmanGold StandardFirst BloodLittle CollectorThis Stuff Is GoodEurekaBaghdad Saviour 42 58,94 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Antisquad 178 -1 0 0,00 0 0.6802074909NEWBIEMERRY CHRISTMASFIRST BLOODSUCCESSFUL RESCUELOSS OF INNOCENCETHE STARAT THE VERY BEGINNING 178 373,53 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
ARK: Survival Evolved 31 -1 0 0,00 0 0.5315436721Your first day...Your first Dino...Your first Ride...Rex RiderMaximum SurvivorMaximum DinosaurGiga Rider 31 37,91 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Asteroid Bounty Hunter 32 -1 0 0,00 0 1.0891666412Close call there, great job.I got a lock on you!Ding ding.My granny would be able to that.Nothing my Karma cant handle.Spend upgrade pointSo you're supposed be a DJ now? 32 44,21 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
AX:EL 22 -1 0 0,00 0 1.0938569307BuilderFireBallBird HunterSpy HunterNo MercyACEPrototype Tester 22 32,47 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Ball laB 20 -1 0 0,00 0 0.9344987273First deathStart10 Deaths20 DeathsOops...50 Deaths100 Deaths 20 25,02 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
BARRIER X 7 -1 0 0,00 0 0.8841120601Let's start the journeyLet the Hunt Begin!Hmm, that was easy!Grand ExterminatorOne More TimeUnstoppableYOU ARE A MONSTER! 7 9,16 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Battlepaths 61 -1 0 0,00 0 0.8836574554Quest CompleteHunterYoungsterCrafterSurpriseMine!Summoner 61 103,60 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Bayonetta 50 0.9771717191Wicked Weave MasterUmbra WitchChapters 14-Epilogue (Normal)Chapters 12-13 (Normal)Chapters 8-11 (Normal)Taste Of The Witching HourMaster Of The Heavens 24 15,85 48 0.7407116294Nice TryTread Not So SoftlyCommander Of MagicDouble, Double, Toil And TroubleTruth In Its Purest FormThe Deepest CutNice And Relaxed 26 36,31 52
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Beholder 38 -1 0 0,00 0 0.5224593878Not a Big DealerFamily GuyPimp My BrideDie Like You Mean ItWhite Papers, Black MailsI Choose ViolenceBilling Them Softly 38 49,18 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Bell Ringer 15 -1 0 0,00 0 1.8906819820SquireEasy CampaignApprenticeAlexander the AdventurerMedium CampaignFighterHard Campaign 15 30,50 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
The Binding of Isaac: Rebirth 245 0.7971163392ButterEra WalkSomething wicked this way comes+!Rules CardBurnt PennyFast BombsStop Watch 185 70,75 75,5 0.3584859669The ScissorsSpelunker BoyDark BoyShadow BabyJudas' ShadowEve's Bird FootRotten Penny 60 46,44 24,5
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
The Binding of Isaac: Afterbirth 98 0.50822442772 new pillsPoker ChipSuccubusRed BabyFate's RewardD8Blind Rage 47 13,54 48 0.2862742543Fart BabyMaw of the VoidCry BabyBetrayalD12Store KeyEden's Blessing 51 25,81 52
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
The Binding of Isaac: Afterbirth+ 63 0.5280697942Void5 Nights at Mom'sMort BabyEucharistLocust of DeathLaz Bleeds More!Locust of Pestilence 19 6,91 30,2 0.2224986851Mr. Resetter!U Broke It!D InfinityLocust of WrathGreed's GulletLiving on the edgeLocust of Famine 44 23,38 69,8
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
BioShock Remastered 65 -1 0 0,00 0 0.5042413473Toaster in the TubCompleted Welcome to RaptureOne Successful HackHacked a Security BotHacked a Vending MachineHacked a TurretHacked a Safe 65 73,92 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Blackout Z: Slaughterhouse Edition 28 -1 0 0,00 0 1.1032489538Pistol x15Kill x10Score 1kScore 5kBody Count x100Die x10SMG x30 28 35,48 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Blockstorm 131 -1 0 0,00 0 0.6647773981Stroke of luckJust One ChanceCarpe DiemPull!ScapegoatTrampolineRage Quit! 131 287,68 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
BloodRayne: Betrayal (Legacy) 12 -1 0 0,00 0 1.3595033884The Last BulletSurvived to Sunrise8 Fingers, 8 BitsChainsplosion!Walking on AirCoffin KickerCollateral 12 22,55 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Bloodsports.TV 57 -1 0 0,00 0 0.6015774012Unleash HellI Am SpartacusFirst StepAre You Not Entertained?Path of BloodPath of ControlPath of Might 57 103,19 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Bloop Reloaded 11 -1 0 0,00 0 1.4839673042Happy DayForce PullerMeteor CollectorThe ThinkerMap CreatorMixerHalfway there 11 19,49 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Bomber Crew 30 -1 0 0,00 0 0.6785020232Bomber CrewPhotographerTarget DestroyedMission SuccessSeven Survive SuccessWinging itAce Encounter 30 36,40 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Borderlands 2 50 1.3895300627Challenge AcceptedWorld TravelerSo Much Blood!Blight ExplorerUnseen PredatorArctic ExplorerHighlands Explorer 49 25,42 98 1.2121970654Did It All 1 1,21 2
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Borderlands 2 - Captain Scarlett and her Pirate's Booty 3 0.5363910794GadaboutCompletionistTreasure Hunter 3 1,07 100 100 0 0,00 0
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Borderlands 2: Commander Lilith & the Fight for Sanctuary 6 0.0092185624Anyway, Here's "Firewall" 1 0,01 16,7 0.11727490283 or BustChocolate Chip ConfirmedDecrypted!Spicy BoyPainbow Connection 5 1,54 83,3
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Borderlands 2: Mr. Torgue’s Campaign of Carnage 3 0.5917748213MotorheadObsessedExplosive 3 0,97 100 100 0 0,00 0
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Borderlands 2: Sir Hammerlock’s Big Game Hunt 3 0.4026846588Been ThereFace Off 2 0,41 66,7 0.4523458481Done That 1 0,45 33,3
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Borderlands 2: Tiny Tina's Assault on Dragon Keep 10 0.5841348171Dang Girl You Ace At This GameHmmmmmIt's Like That One VideoGirl's Gotta EatKeep Rollin' Rollin' Rollin'Shorty, You So BestThey Was All "Hey That's Mine" 9 2,24 90 0.4532905221Make it Raaaaaid 1 0,45 10
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Borderlands 3 45 0.5143079758Mechani-CoolTips AppreciatedStay GoldenÀ La CarteBye, Felicia!I Am A Goddess, A Glorious Female WarriorDamn, Gina 25 9,00 55,6 0.4050513208Stay Away From The LightBiggest Badass In The BorderlandsI Hope You Didn't Tea-bagStick It To 'EmMy Name Is EarlTales From The Eridian SlabExoarchaeolo—You Get The Gist 20 18,67 44,4
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Borderlands GOTY 50 0.5935322046Down in Front!Destroyed the HiveDiscovered Trash CoastWanted: KromMade in FyrestonePandora-dog Millionaire12 Days of Pandora 28 10,82 56 0.4226975441Group LF HealerThere's No "I" In "Team"FacemelterUnited We StandAnd They'll Tell Two FriendsDiscovered Crimson Lance EnclaveDiscovered Eridian Promontory 22 15,03 44
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Borderlands DLC: Claptrap’s New Robot Revolution 10 -1 0 0,00 0 0.7730001211Knoxx-TrapNed-TrapSteele-TrapMuerte la robo-luciónIt's so realistic!The CollectorTourist 10 9,88 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Borderlands DLC: Mad Moxxi's Underdome Riot 5 -1 0 0,00 0 0.8603950143Small TournamentThe GullyHell-BurbiaThe Angelic RuinsBig Tournament 5 6,07 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Borderlands DLC: The Secret Armory of General Knoxx 10 -1 0 0,00 0 0.5500737429Making a MonsterAthena, OutDepot DemolitionSpeed KillsDing! OverleveledDing! Overleveled to 11Sneaky Little Buggers 10 8,81 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Borderlands DLC: The Zombie Island of Dr. Ned 5 -1 0 0,00 0 0.5206005573House of the NedJakobs FodderNed's Undead, BabyNight of the Living NedBraaaaaaaaaaaaains! 5 3,17 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Borderlands GOTY Enhanced 80 1.0046609640Truly OutrageousWanted: SledgeThere are some who call me...TimDiscovered Headstone MineGet A Little Blood on the TiresFenceRootinest, Tootinest, Shootinest 15 11,50 18,8 0.7995291352Ding! ExpertWeapon AficionadoPaid in New HavenDing! Hardcore1.21 GigawattsDiscovered The ScrapyardPandora-dog Millionaire 65 80,51 81,3
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Borderlands: The Pre-Sequel 50 1.4034115076Cosmic CompletionistLunar LooterWho Needs Air?The Gun In The StoneEridian ExplorerNo, I'm Athena!Space Lord 39 30,92 78 0.8357812762Mouth To MouthDo Shoot the MessengerAir SupremacyMoon Mission MeisterExecutionerMoxxi's SamplerCollateral Damage 11 13,93 22
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Claptastic Voyage and Ultimate Vault Hunter Upgrade Pack 2 10 0.6686462760No Photographs, Please!Sociopathic NetworkerShadow of Your Former SelfShadow PlayTotally RecalledSmash and Not GrabDigitize Me! 7 1,71 70 0.3260097802It's Raining Cats and HotdogsWheely FastThe Gift that Keeps on Giving 3 1,49 30
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Borealis 17 -1 0 0,00 0 0.9169360399VoyagerToo Zen to CareHipsterComposerTrackerNautilusZen Baron 17 26,08 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Braveland 21 -1 0 0,00 0 0.7211626172First FollowerFlawless VictoryStudentShoppingBachelorCrime and PunishmentLucky 21 20,19 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Brütal Legend 59 -1 0 0,00 0 0.4754764736Got a Car and a DateStart a RevolutionThick as a Baby's ArmOne Hit WonderHair RemoverFrench Kiss InstructorChicks n' Booze n' Stuff 59 89,82 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
The Bureau: XCOM Declassified 34 -1 0 0,00 0 0.6732662320All That RemainsDead HeadBringing down GoliathThe Last Suit You'll Ever WearIs He Old Enough to Drive?So Just Let Me Introduce MyselfAway Team 34 40,88 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Call of Juarez Gunslinger 26 -1 0 0,00 0 0.4047657847Keep At ItThis Time for RealDeath From AboveThere's More to ItFor Massive DamageStaying AfloatTrue Story 26 24,91 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Candy Blast 18 -1 0 0,00 0 1.1193932295First StepGood startWay to goEverybody make mistakesYeah, greatWhat are you doing?Muffin pack complete 18 29,84 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Canyon Capers 30 -1 0 0,00 0 0.5305177569The easiest achievement you'll ever earnCatlike ninja abilitiesRed, Blue and GreenCoin Collector3 star hero.Treasure TroveTalent spotting... 30 42,73 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Capcom Arcade Stadium 20 -1 0 0,00 0 0.9998402596Welcome to the StadiumIf I Could Turn Back Time...Tempo ConductorTrend FollowerFirst FailureCoin ConsumerFuture High Score Lister 20 30,77 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Cataegis : The White Wind 41 -1 0 0,00 0 1.3561829329More to ComeMissile DividerFried FlierSplit SpearsTowards the ZigguratBring ItI'll have that turret 41 85,92 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Cave Story's Secret Santa 10 -1 0 0,00 0 1.4063003063I Feel AsleepSaved ChristmasBlockedSanta's ListThe OrangeCookie MonsterRampage 10 15,34 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Chaos Domain 39 -1 0 0,00 0 1.2973692417Wind of HorusThe Blessed DeadBlack Seeds of VengeanceAt the GatesAnnihilation of the WickedThe Pills I’ve TookS.T.A.L.K.E.R. 39 83,34 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Chip 22 -1 0 0,00 0 0.6009856462The Quest BeginsOver 9000Robot In DisguiseShifting GearsPrison Break!Just Can’t Wait To Be KingUpgraditis 22 30,41 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Chivalry: Medieval Warfare 49 -1 0 0,00 0 0.5526044965Reach level 5Two handed weapon UnlockedVultures ChefBastard weapon UnlockedReach level 10One handed sharp UnlockedCupid 49 60,15 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Chompy Chomp Chomp 27 -1 0 0,00 0 1.0411412716Yellow ChainPurple ChainChompyAlternating Bonus 2Alternating Bonus 1ChomperDeathwish 27 37,65 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Chronicles of a Dark Lord: Episode 1 Tides of Fate Complete 46 -1 0 0,00 0 1.8053916693Birth of the Dark LordDeadly CoupleNo Honor Among ThievesWrath of the SeasWhat is it with you and Bridges?Rim Kingdoms RampageI Hate Snakes 46 108,09 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Cloud Knights 33 -1 0 0,00 0 2.1859576702IndestructibleWhoops!Didn't Get FarSo CloseTeam PlayerDefeat the Undead ChampionAxe Brawler 33 78,08 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Company of Heroes 2 378 -1 0 0,00 0 0.7404863238M.01 - German EngineeringCampaign ConscriptStalingrad Rail Station - ConscriptSenior PrivateComp-Stomp ConscriptM.01 - Compassion in WarStalingrad Rail Station - Captain 378 643,20 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Cortex Command 11 -1 0 0,00 0 0.6003159285Hello There!So That's What It's AboutTechnical WinAren't You CleverPyrrhic VictoryThese Guys Are Awesome!One Star General 11 15,80 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Counter-Strike 2 1 -1 0 0,00 0 0.8271363378A New Beginning 1 0,83 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
CPU Invaders 13 -1 0 0,00 0 0.94656050211234100056 13 15,30 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Crash Bandicoot™ N. Sane Trilogy 74 0.8041826487C3 | Tiny TrouncedC3 | Taking the Scenic Route 2 1,51 2,7 0.3222586215C1 | Spin DoctorC1 | That's What Those Do!C1 | Papu PoppedC1 | I Meant To Do That!C1 | Feeeed Meeeee!C1 | Ripper RuinedC1 | The Box That Broke the Bandicoot's Back 72 73,63 97,3
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
CrimeCraft GangWars 46 -1 0 0,00 100 0.7913187742Key to the CitySnow Ballin'One Star BadgeArmsdealerRespect from Your PeersGear GeekThe Outfitter 46-46 71,94 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
CRSED: Cuisine Royale 13 -1 0 0,00 0 0.5508894920Ready to fight!First bloodDark gods championUnstoppableThe invisible manGunslingerThe king 13 24,12 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Crusader Kings II 32 -1 0 0,00 0 0.9822708368The Marriage GameFull HouseUntil Death Do Us PartAlways Bet On DukeRoyal BloodCrusaderIt's Good to be the King 32 52,76 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Cubetractor 13 -1 0 0,00 0 1.7270998955Placer of the CubesCritter HunterCubeXaminatorSteamrollerA touch of CubeManshipBipolar CubeXpeditionAs if that weren't enough! 13 27,34 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
The Culling Of The Cows 5 -1 0 0,00 0 0.5456729531Tutorial CompleteGun UpgradeHoly AssistanceBuckshotKill The Nazi Ufo 5 3,92 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
DARK SOULS™ II: Scholar of the First Sin 38 0.6856583357Selfless GiverHolder of the FortAbysmal CovenantVendrickSanguinary CovenantReflections on DisembodimentProtector Covenant 24 10,82 63,2 0.5408177376The HeirGarrulous MiserCovenant of AncientsGathering of ExilesCurious MapSmith for LifeLucatiel 14 12,37 36,8
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
DARK SOULS™ III 43 0.9692430496Master of SorceriesThe Usurpation of FireUltimate EstusUltimate BonfireCovenant: Blade of the DarkmoonCovenant: Aldrich FaithfulThe Nameless King 35 12,54 81,4 0.5507397652To Link the First FlameThe End of FireMaster of InfusionMaster of PyromanciesMaster of ExpressionMaster of MiraclesMaster of Rings 8 7,22 18,6
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
DarkEnd 26 -1 0 0,00 0 1.8006794453Into DarknessCorrupt No More!The Princess is in another castleHeigh-Ho!BeginnerItJust a Pebble in a Pot 26 54,92 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
The Darkness II 50 -1 0 0,00 0 0.4952449203Jackie's Got TalentCheque Please!I'm Just Getting StartedMmmm Essence!Escape the BrotherhoodStorm the MansionOne Flew Over... 50 52,77 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Darksiders II Deathinitive Edition 50 -1 0 0,00 0 0.6418313980Crow CarrionLooks FamiliarFire of the MountainPathfinderGrim ReapingTears of the MountainTo Move a Mountain 50 61,13 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
David. 21 -1 0 0,00 0 0.6865429878Finished Intro.Greed on Very.Anger on VeryWolf on Very.Anxt on Very.Lies on Very.Brood on Very. 21 24,91 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Dead Island: Epidemic 54 -1 0 0,00 100 0.4586341083Met with SinamoiZombie abuserLargest of preyJust going throughZombies are my friendsGreat attackBlueprint collector 54-54 91,05 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Dead Realm 37 0.3054871857Is It Gone?My First Haunting 2 0,59 5,4 0.4907429814Children's Fairy TaleWill the Real One Please Stand Up?BubbiliciousThe Secret is OutI am going to get you suckaWhat Time Is It?Legendary Ghost Juker 35 66,03 94,6
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Dear Esther: Landmark Edition 10 -1 0 0,00 0 1.1765846014DonnelleySeonaidhJakobsonEstherPaulStac an ArminMan of the Rocks 10 13,39 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
The Deed 17 -1 0 0,00 0 1.2216935158First DegreeIt Takes A RatUnsolvedShatteredNooseBruteSlashed 17 23,03 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Defend Your Life 20 -1 0 0,00 0 0.7259426713First winMedicBoss killerDoctorChuck NorrisBuilderBombara 20 23,84 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Defy Gravity 8 -1 0 0,00 0 0.4842274487Basic Training CompleteGravity ApprenticeGravity WarriorMaster GravitymancerGrand Master GravitymancerGravitymancer EmperorThe True Challenge has just begun 8 7,40 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Deiland 24 -1 0 0,00 0 1.3586323261PEASANTLUMBERJACKBLACKSMITHHUNTERMASTER BLACKSMITHEXPLORERMINER 24 38,69 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
The Descendant 10 -1 0 0,00 0 0.9603064060At World’s EndI've Got a Bad Feeling About ThisBig Bada Boom!Master of NoneAt Episode’s EndSimmer DownHostile Work Environment 10 11,89 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Destiny 2 13 0.5762337446Ikora's ProtégéThe People's HeroLong and Winding Road 3 1,17 23,1 0.4717260003Cayde's PathfinderHeart of DarknessZavala's LieutenantIn A FlashLest Ye Be JudgedShow Me What You GotThe Life Exotic 10 7,27 76,9
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Devil Daggers 1 -1 0 0,00 0 2.4526340961Devil Dagger 1 2,45 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Devil May Cry 5 51 -1 0 0,00 0 0.1482242197Fall from GraceNot Too ShabbyReunionSteppin' up the StyleEnd of the LineBreak a LegSeriously Stylish Slaying! 51 41,84 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Devil May Cry HD Collection 99 0.8666118383Smashing SensationBlood Flows RedLocked 'n LoadedBrotherly LoveGun CollectorRough RiderLights Out 32 21,96 32,3 0.7328159213Hot As HellThat's Not Lady-LikeCan You Keep A Secret?Step Into The LightAsylumMonkeying AroundHell of a Start 67 84,27 67,7
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Dino D-Day 77 -1 0 0,00 0 0.6882598996I choose you!Give 'Em the BirdBite the Hand that Feeds YouPull!Hock a LugerYou Can't Go Home AgainExercise your options 77 112,78 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
DiRT 3 Complete Edition 60 -1 0 0,00 0 0.4440665841Into the DiRTReputation BoostToday's Forecast is...Victory!Rising TalentDriving SchoolKick Off the Training Wheels!Watch the Paintwork! 60 85,56 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
DiRT Showdown 49 -1 0 0,00 0 0.6421267390Welcome to the ShowDemolition!Mixed GrillJack of All TradesDon't Push MeCrash-Bang-Wallop - What a VideoPro 49 69,48 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
DISTRAINT: Deluxe Edition 16 -1 0 0,00 0 0.7829725146The First DistraintCoffee, Please!The Fire MakerThe Second DistraintWhere Is Your Dignity?The ElectricianSniff This! 16 15,80 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
DOOM 39 1.1858534813Arcade StockpileHot SwapperArgent FiendUp Close and PersonalTiming is EverythingJuicin' it upKnee-Deep in the Dead 21 9,24 53,8 0.6775040030IPXSETUP.EXECombat tested, Doomguy approvedThe Circle is CompleteOverclockedEvery Nook and CrannyNo Rest for the LivingHistorian 18 20,79 46,2
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
DOOM 3: BFG Edition 65 1.6267044544DOOMed CollectorNinja KillerTelefragged!Crushed!Berserked!Clean SheetI Like to Watch 60 72,34 92,3 1.0262135267To Be or Not to Be2 Deaths - 1 GunDOOMed NightmareLost NightmareEvil Nightmare 5 7,74 7,7
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
DOOM Eternal 36 1.4925037622Game OverReinvent the Weapon WheelLet's PlayMaster of FastingGunpletionistTreasure HunterPlayset Sold Separately 29 17,71 80,6 1.2969931364Mix and MatchFight Like HellRunning Up the High ScoreMan vs MonstersTruce between DemonsWeapons ExpertBlood Bath 7 9,95 19,4
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
DOOM Eternal: The Ancient Gods - Part One 7 0.3394365609HypersonicRequired ReadingLucky Charm BraceletRegime ChangeTo Take a Life SphereTorrential Pain 6 1,13 85,7 0.69947189091-Upsmanship 1 0,70 14,3
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
DOOM Eternal: The Ancient Gods - Part Two 7 0.1783518791Critical LiteratureRest Your Weary FistsSiege the DayTougher Than NailsCross the ThresholdCrystal Spelunker 6 0,31 85,7 0.6008375287Live Die Reload 1 0,60 14,3
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Door Kickers 43 -1 0 0,00 0 0.3669548929I'm doing itNow I have a machinegunEnough for a SparkI'm getting goodPersistence is keyThey can do itEvery life matters 43 49,45 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Double Dragon Neon 29 0.5077161193Is That a Quarter? 1 0,51 3,4 0.6532994509Put Your Heads TogetherA Boo BooMetal HeadBro-merangTossin' on AirAudiophileVictory! 28 41,07 96,6
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Drawful 2 10 -1 0 0,00 0 0.8575568795Happy Birthday Two HuesThreestyleFool HouseMultiple StrokesWait, Why Are We Rewarding This?The Student Becomes the WriterIt's a Secret 10 14,22 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
The Dream Machine 13 -1 0 0,00 0 1.6614549160Island LifeThe New HouseAlicia's DreamElectrical EngineerEnd Chapter 1Mind Blown'I Have A Feeling I'm Being Watched...' 13 25,14 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Drones, The Human Condition 9 -1 0 0,00 0 1.5338094234TweakerOff to the ScrapyardDebt FreeIn the Main-FrameThe DecommissionerHack the GibsonDead Beef 9 16,05 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Duke Nukem 3D: 20th Anniversary World Tour 27 0.8237829804That's What She SaidI Never Knew This Was HereDoomed MarineTake No PrisonersShake It, BabyAll Too Easy 6 3,75 22,2 0.7203800082It HappensPiece of CakeNukem AllInvaders Must Die!I Never InhaledSmoke 'Em If You Got 'EmCheating! 21 18,45 77,8
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Duke Nukem 3D: Megaton Edition 20 1.5118546486Hail to the King, BabySee You in HellGonna Rip Em' a New OneLimbo time!I've Got Balls of SnowThe Patriot ActDuke, Use The Force! 20 20,69 100 100 0 0,00 0
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Dungeons 2 25 -1 0 0,00 0 0.8130476475Little SnotUgh, Daylight!The King is Dead, Long Live the Evil!Cleaned out the Crystal ChamberStay and fight, you coward!Mine SuperintendentThe Last Unicorn 25 32,81 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Eador. Masters of the Broken World 56 -1 0 0,00 0 1.2008541822The Glorious OpeningThe Obnoxious CompanionThus Began the EmpireA Career in the MakingThe Royal GuardReanimationPathways to Mastery 56 101,31 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
The Elder Scrolls V: Skyrim 50 -1 0 0,00 0 0.0671032071UnboundBlessedApprenticeDragon SoulBleak Falls BarrowAdeptThe Way of the Voice 50 21,73 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Endorlight 1 -1 0 0,00 100 50Developer achievement 1-1 0,00 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Enemy Mind 34 -1 0 0,00 0 1.0297707319Beep Beep!EnsignLeap of FaithEmpathic ConditioningLieutenantReflectionsVeteran 34 68,63 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Estranged: The Departure 14 -1 0 0,00 0 1.2076059580Master MarksmanDeadly FishermanWeather for DucksWell HydratedMaster Water CollectorIsolatedFlushed Away 14 20,78 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
EvilMaze 37 -1 0 0,00 0 0.7980531454LEVEL 10MONSTER BOOKLEVEL 9WEAPON SCROLLLEVEL 8Secret RoadLEVEL 7 37 48,63 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Evolvation 133 -1 0 0,00 0 1.67775881291 Deaths1 Games Played1 Kills1 Free For All Wins1 Team Deathmatch Wins10 Deaths10 Kills 133 289,78 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
F1 2015 45 -1 0 0,00 0 1.3246723413Pole SitterMe, Myself and I1, 2, 3, PodiumOne AimOne with the CarOnline WinnerClean Club 45 86,07 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
F1 2018 50 -1 0 0,00 0 0.8846669197Out of the gatesIt's still good, it's still goodStepping upIt's the little thingsBest seat in the houseGreat expectationsBack on track 50 77,21 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Faeria 59 -1 0 0,00 0 1.3409922123Welcome to Faeria!Mission completeTo the FaceSlayingBurnSkilled AdventurerSlaughter 59 135,49 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Fairy Bloom Freesia 50 -1 0 0,00 0 0.5451763868Guardian of Lita ForestPixie PugilistVengeful Tidal Wave of FistsAriel RaveNimble Little MinxA Fairy and a SadistCombat Pro 50 63,76 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Fallout 4 50 0.7258421779…The Harder They FallWasteland D.I.Y.Armed and DangerousLovableTradecraftInstitutionalizedThe Molecular Level 33 11,72 66 0.5618403554Legend Of The WastesPrepared for the FutureMankind-RedefinedRobCo's Worst NightmareThe Nuclear OptionPowering UpThey're Not Dolls… 17 13,79 34
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Fallout 4 - Automatron 5 0.1156474203Robot HunterMechanical Menace 2 0,13 40 0.1429716945HeadhuntingRestoring OrderThe Most Toys 3 0,47 60
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Fallout 4 - Contraptions Workshop 3 0.6212570667Show Off 1 0,62 33,3 0.6130242348Time OutMass Production 2 1,33 66,7
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Fallout: New Vegas 50 0.8935161233Little WheelReturn to SenderYou'll Know It When It HappensThe BossOne Armed BanditBlast MasteryOutstanding Orator 23 12,31 46 0.6551003456Double DownMaster of the MojaveHack the MojaveNew Vegas SamuraiWild CardStim-ply AmazingTalent Pool 27 27,63 54
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Fearless Fantasy 24 -1 0 0,00 0 1.0040028095Damsel in DisguiseEpic for BeginnersSock MuppetBeard of PreyHydra DownParty CrasherEpic for the Advanced 24 36,99 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
The Flame in the Flood 36 -1 0 0,00 0 1.0688700676Stay WarmPay It ForwardThe GreySnake CharmerI been everywhere, manHigh GroundPack Rat 36 67,89 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Fortified 23 -1 0 0,00 0 1.3348060846Ivy LeaguerGoose It!Big SpenderReporting For DutyIce to Meet YouBring Him Down!Circuit Breaker 23 44,10 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Fractured Space 34 -1 0 0,00 0 1.3544859886BloodedCommittedTakedown MasteryDamage Rank 1Capture Mastery 10Starship Technician: USRStarship Technician: TDS 34 70,34 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Freebie 5 -1 0 0,00 0 0.804803550210 points!20 points!30 points!40 points!50 points! 5 4,63 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
GabeN: The Final Decision 13 -1 0 0,00 0 0.7691037059Thanks for playing GabeN: The Final Decision! GabeN appreciates that! ;)Robin DefeatedNihilanth DefeatedFire Illuminati Commander Rekt!Earth Illuminati Commander Utterly Destroyed!Ice Illuminati Commander Burned...Administrator murdered. 13 17,85 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Gene Shift Auto 40 -1 0 0,00 0 1.2216259241OWNAGEChicken DinnerUNSTOPPABLELast Man StandingMassacreGODLIKEResurrection 40 77,90 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Gravity Badgers 18 -1 0 0,00 0 0.7035833597Badger of HonourYou must like BadgersWelcome to the Gravity BadgersGravity Badger CaptainOpened up a whole can of wormsCome at me Badger!Quit badgering me! 18 22,61 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
GRID 2 50 -1 0 0,00 0 0.3817219138Here's My Number, Call Me Maybe?Sideways ShenanigansSWAGtastic!T3XT M3SSAG1NG I5 GR8A Vision of What's to ComeWinging ItMo Money, No Problems 50 57,29 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Guacamelee! Super Turbo Championship Edition 30 -1 0 0,00 0 0.7688184977Viva La ResurrecciónDo or Do NotFlawlessThat's one big Gato FritoPower WithinMain EventThat was INTENSE 30 38,36 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Gun Monkeys 8 -1 0 0,00 0 0.8549920321Prime MateMonkey FeverStill AliveCheeky MonkeyWinning Streak!CocktailFly, Monkey, Fly! 8 9,66 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Guns of Icarus Alliance 849 -1 0 0,00 0 0.8971146941Hands OnThe Grand TourLook AliveStop, Drop, and RollBroad Side of a BarnHow Stuff WorksBody Work 849 2484,45 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Guns of Icarus Online 849 -1 0 0,00 0 0.4918412566Hands OnThe Grand TourLook AliveBroad Side of a BarnHow Stuff WorksStop, Drop, and RollBody Work 849 2542,45 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Gurumin: A Monstrous Adventure 53 -1 0 0,00 0 0.9215810299Forward SlashDrill TornadoCooking With GasPnuematic DrillBoomboxCouchBattery Powered Drill 53 83,90 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Hacknet 11 -1 0 0,00 0 0.7368526459EntropyCSECMakeover!To the WirePointClickerYou better not have clicked for those...Hacknet 11 12,40 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Half-Life 2 69 1.1047599316Lambda LocatorKeep Off the Sand!Hack Attack!Zombie ChopperFlushedCounter-SniperVorticough 33 20,73 47,8 2.4804871082Gnome AloneWatch Your Head!ContainmentElevator ActionAcid ReflexAttica!Into the Breach 36 96,23 52,2
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Half-Life 2: Episode One 13 1.0856721401Zombie-queThe One Free BulletConservationistPacifistCar CrusherThink Fast!Live Bait 13 10,47 100 100 0 0,00 0
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Half-Life 2: Episode Two 23 -1 0 0,00 0 0.4513467252Acid ReflexInto the BreachTwoferMeet the HuntersGunishment!Deadly HarvestQuiet Mountain Getaway 23 17,54 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Half-Life 2: Update 33 -1 0 0,00 0 0.4985754490MalcontentTrusty HardwareSubmissiveAnchor's Aweigh!Barnacle BowlingDefiantHeavy Weapons 33 29,67 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Halo Infinite 75 0.7762700319They See Me Rollin'Peak PerformanceI'm Ready, How 'Bout You?We Have a Job For YouClocking In 5 2,01 6,7 0.3768746853Passion for FashionHumble BeginningsWhich One of Us is the Machine?Reporting for Duty"Need a Weapon?"BrutalityLimited Addition 70 97,31 93,3
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Halo: The Master Chief Collection 84 0.4541823864Delicious BrainsThe Guardians Are ComingJust A TasteBite The HandSpoilsportThe One PercentStick With It...A Little Longer 11 2,83 13,1 0.3526681364Standard Operating BrocedureAll Out of BubblegumGoing BananasBrovershieldGame OnGruntageddonA Pile of Medals 73 87,55 86,9
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Halo 2: Anniversary 158 0.5819769502EnamoredInspectorExaminerBoundlessHeresy Will Not Stay My FeetFascinatedRipple Fire 16 4,59 10,1 0.2352405488Go Ape ShivSacred IconQuarantine ZoneGravemindHigh CharityUprisingThe Great Journey 142 141,70 89,9
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Halo: Reach 100 0.7930262089Game BreakerEnemies Everywhere!Easy to OverlookI'm Sorry, Dave 4 1,69 4 0.1235308051We're Just Getting StartedProtocol Dictates ActionI Need A WeaponMind the Skill GapTo WarYou Flew Pretty GoodInto The Howling Dark 96 95,01 96
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Headsnatchers 52 -1 0 0,00 0 1.0908423662You found us!Ooh Stickers!New found landNetheadI'm just getting startedPlease don't hurt meThe Walking Heads 52 105,65 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Hektor 16 -1 0 0,00 0 1.6991630793Sorry I’m late, BossUnderdogThick SkinDown the Rabbit HoleDisobedientA.E.A.God Mode 16 33,07 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Hell Yeah! 12 -1 0 0,00 0 0.7346138954Armed and dangerous!Pimp that wheel!Fashion victim!Good santa!Quick rabbitIsland's masterBug tracker! 12 13,94 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
HELLION 12 -1 0 0,00 0 1.7748798132Rude AwakeningHome Sweet HomeSafe HavenEchoes From the PastAmnisos WaystationBurned RuinsWalking In Her Shoes 12 25,24 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Heroine's Quest: The Herald of Ragnarok 46 -1 0 0,00 0 1.3046855927So You Want To Be A HeroineMenace to SocietyIn Loving MemoryApprentice WarriorWages of WarWi nøt trei a høliday in Sweden this yer?Apprentice Sorceress 46 77,52 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
High On Racing 15 -1 0 0,00 0 1.5365155935Level 1Level 2Level 3Level 4Level 5Level 6Level 7 15 27,33 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
HITMAN™ 24 -1 0 0,00 0 0.3031411469ShhhhUnseen AssassinThe Result of Previous TrainingChameleonCleared for Field DutySeizing the OpportunityWhen No One Else Dares 24 20,71 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
HITMAN™ 2 17 -1 0 0,00 0 0.4127622545ShhhhUnseen AssassinChameleonCleared for Field DutySeizing the OpportunityTools of the TradeThe Result of Previous Training 17 16,55 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Homefront 47 -1 0 0,00 0 0.6103147268ChroniclerWhy We FightFreedomFire SaleThe WallHeartlandOverwatch 47 66,53 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Horizon Shift 12 -1 0 0,00 0 1.1770371199That's a Good StartOne DownBoom!Big Boom!Horizon Hero1UpFlawless Victory 12 24,27 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Horror Hospital 42 -1 0 0,00 0 1.14404487611 HourFirst pictureYou found battery 5 timesFirst mission3 HourYou found battery 10 timesYou found 5 picture 42 61,96 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
How to Take Off Your Mask 27 -1 0 0,00 0 0.8203718066Prologue Cleared!First Transform!Chapter 1 Cleared!Chapter 2 Cleared!All Music Tracks Unlocked!Chapter 3 Cleared!Chapter 4 Cleared! 27 24,08 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Hyperdrive Massacre 34 -1 0 0,00 0 1.5492445230Starting SmallWhoopsNo JoyHyperplayerIn the Fable, the Tortoise WinsSuicidal TendenciesSelfless 34 69,49 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
IMSCARED 11 -1 0 0,00 0 0.5160605311The first KeyPeek-a-BooGame EndedMaster TagThanks for stayingNot to SeeGame HEnded 11 8,52 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
In Between 16 -1 0 0,00 0 1.1298990250FragmentsKnowledgeEmbrace your fateDefy GravityCourageSerenityUnity 16 29,21 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
in My MIND. 1 -1 0 0,00 0 1.2349314690Overcome 1 1,23 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Injustice: Gods Among Us Ultimate Edition 50 -1 0 0,00 0 0.6307494640Unstoppable ForceFINISHEDSidekickWrecking BallStatistical AdvantageAlmost ThereLooking Good! 50 73,22 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Insurgency 100 -1 0 0,00 0 0.4101931155Ground Control IGround Control I (Coop)War Hero IFirst BloodFirst Blood (Coop)Bodycount I (Coop)Bodycount I 100 143,87 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Ionball 2 : Ionstorm 26 -1 0 0,00 0 1.3486819267NoobFeelin' hot, hot, hot!Amazeballs!The JugglerRiposte!IonballPro ball-handler 26 50,38 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Jet Gunner 37 -1 0 0,00 0 1.2506214380The BeginningGetting StartedJungle FeverBeat That TimerRobot CopBad For Your HealthBattle Blimps 37 71,40 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Jet Set Radio 30 -1 0 0,00 0 0.5978916287Feel the BeatWe got us a crewI Need a ParachutePublic MenaceLook BehindRemixes Suck!Unlock Garam 30 53,26 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Kabounce 50 -1 0 0,00 0 1.0779169798SchooledLevel up!EliminationGraduatedShinyMost Valuable PinballSharp Shot 50 93,66 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Kao the Kangaroo: Round 2 9 -1 0 0,00 0 1.2692222595Got any money?Still need more to pay that rotten Bossman off...Shinies!3000 ducats or else… nothingNeed for SpeedboatWho is "puny" now?Seadog 9 14,05 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Keen Dreams 16 -1 0 0,00 0 1.8205422163King of Horseradish HillAce at Apple AcresSuperlative at Squash SwampBoss of Brussel Sprouts BayBest at Bridge BottomsRhubarb Rapids RoyaltyPerfect at Parsnip Pass 16 31,76 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Killer is Dead 48 -1 0 0,00 0 0.5757179856Kidnapper ExecutedToast to ForerunnerAlice in Dead LandSuck Like a LeechHave You Got Clean Hands?9 to 1 on GoliathHad a Bad Dream 48 69,41 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Killing Floor 285 1.5406382084Cave of WonderCattle ClassBlinding Big BrotherScience HaterNitro Boost!DeathTurbo Executioner 69 57,71 24,6 0.6483466029Too Close For ComfortWindjammer EnthusiastLet Them BurnEggnog Anyone?Flaming Hell, That was CloseCombat MedicBurning up the Midway 216-1 304,02 75,4
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Killing Floor 2 307 1.0829535723A Special DealCleanup On Aisle 3Death's DoorCastle CrashersSpooky Scary SkeletonsPowered by SteamBundle of Switches 35 19,76 11,4 0.3383410275Tower TussleYou Can't Fight In Here, This Is The Control RoomReach Level 5 SupportWin 10Reach Level 5 GunslingerPlow the FieldALAN!!!!!! 272 289,79 88,6
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Killing Floor Mod: Defence Alliance 2 30 -1 0 0,00 0 2.7120771408Lucky damageClot ChampionSetup the defenceAlliance 1 - 0 ZombiesGorefast ChampionBloat ChampionYou're a teamplayer 30 82,67 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
King's Guard TD 10 -1 0 0,00 0 1.0469043255Arrow TowersBloodMytinaWarriors DownLegacyDestructionDragon Killer 10 16,06 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Kingdom: Classic 34 -1 0 0,00 0 0.6526781321Day VDay XDay XVDay XXDay XXVDay XXXDay XXXV 34 48,26 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Krater 41 -1 0 0,00 0 0.4497515559The HangoverManagement by FearHound SlayerLord KitchenerKratercraftMagellanMo..mo..monster kill 41 71,89 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Lara Croft and the Temple of Osiris 40 -1 0 0,00 0 1.0662115812Gotta start somewhereA journey beginsWhat's in the box?Bling me up!Time keeps on ticking, ticking, tickingUp for a challengeWhy's it have to be snakes? 40 63,71 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Layers of Fear (2016) 18 -1 0 0,00 0 0.6788350344It's covered up for a reasonIt rings a bellWandererScraps of loveThe artist's impressionInspired OCDArtist's struggle 18 21,59 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Left 4 Dead 2 101 1.7536604404ONE HIT WONDERI SPIT ON YOUR GRAVEHEARTWARMERLICKETY-SPLITGOOD GUY NICKBEAT THE RUSHTHE QUICK AND THE DEAD 63 47,71 62,4 0.8037964702Valve Gift Grab 2011 – L4D2HUNTING PARTYSCAVENGE HUNTCACHE AND CARRYFUEL CRISISMUTANT OVERLORDROCKY HORROR PICTURE THROW 38 55,77 37,6
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
The LEGO® NINJAGO® Movie Video Game 50 -1 0 0,00 0 0.9386568666Student of UpgradesMaster of PoultryNovice of CollectionStudent of DisguiseStudent of the Red ArtsMaster of MissilesNovice of The Golden Art 50 73,25 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
LEGO® The Hobbit™ 39 -1 0 0,00 0 0.7807890773A city turned to ashIn a hole in the ground...Slunk back from whence he cameHardly burglar material... And be stone to you!More of a letter-opener, really!More than a thunderstorm! 39 49,88 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
LEGO® The Lord of the Rings™ 48 -1 0 0,00 0 0.5313078165The strength of Men failed.It's a dangerous business...That is no trinket you carry.Great! ...Where are we going?The long way around.This is no mine... it's a tomb.Let's hunt some Orc! 48 53,72 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Life is Strange 2 9 -1 0 0,00 0 0.7134972215SketchyA Long Road AheadBear AwareBonus MilesRangerTrail AngelRoom Service 9 8,34 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Life is Strange™ 12 -1 0 0,00 0 0.3605908155Macro EyesChrysalisRed EyeTelephotogenicLight LeakFocusedZoomed In 12 8,44 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
LIMBO 13 -1 0 0,00 0 0.4493570924Altitude is AttitudeWrong WayWhere Credit is DueAlone in the DarkBacktrackingGuided by SparksUrban Exploration 13 11,53 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Little Nightmares 13 -1 0 0,00 0 0.7195202708The PrisonHighly SprungThe LairThe KitchenThe Guest AreaThe Lady's QuartersElusive 13 15,04 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Little Racers STREET 43 -1 0 0,00 0 0.6498349309My first car - Class EA star is bornRed go fasta!The Love BugUnexpected victorySo much power!Bad day 43 61,43 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Lost Ark 156 0.2146378607Basic TrainingA Leading Life 2 0,38 1,3 0.1792281717Priest Named ArmenSkill ResearchAdventurer of YudiaPathfinderCard CollectorAdventurer of West LuterraWhat Truly Shines 154 174,02 98,7
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Lovely Planet 14 -1 0 0,00 0 0.9042177796True SamuraiHarakiriAce CityHungry SamuraiGravesAce VillageAce Forest 14 21,27 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Lowglow 12 -1 0 0,00 0 1.1140064001First Chapter CompletedNo Drop Left BehindOver AchieverSecond Chapter CompletedThe Line KingOpen Sesame!Third Chapter Completed 12 16,71 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Lucius 58 -1 0 0,00 0 0.4439838231First bloodDouble murderThere is no answerGetting the hang of itWe got ourselves a readerSerial killerAre You There God? It's Me, Lucius 58 54,31 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Mad Dojo 17 -1 0 0,00 0 1.2460125685Mad DissolverMad Early BirdMad SpikeMad Level 5Mad ShurikenMad Level 10Mad Level 15 17 31,67 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Magrunner: Dark Pulse 24 -1 0 0,00 0 1.1298757792Tech WizNaturalQuick ThinkingMagtech EngineerBeam RiderCompetitorLooking Glass 24 37,88 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Martian Law 6 -1 0 0,00 0 1.6850612164Little Martian that CouldIron FieldsCome Get SomeCapital CityAlways Bet on GreenWelcome to Mars 6 10,79 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Masked Shooters 2 12 -1 0 0,00 0 0.9367102385First DeathFirst Blood10 killsVictoryHitmanBombasticMasked Elite 12 12,83 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Master Reboot 20 -1 0 0,00 0 0.6735445261INDUCKTIONAM/FMTHE VIRUS, THE GLITCH & THE WARDROBEDUCKTECTIVEFIRST CLASS TICKETHEAVY READINGWELCOME TO THE SOUL CLOUD 20 26,85 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Meadow 137 -1 0 0,00 0 0.7148807049A curious start - Badger CubHappyAspiring floristClimbing up in the worldConversationalistNew coatFrog 137 233,78 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Mechanic Escape 33 -1 0 0,00 0 0.9972233176LocustTenaciousRookie riderDaredevilMonkeyTirelessFrog 33 47,08 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Megabyte Punch 30 -1 0 0,00 0 1.0299940109Bouldar down!100 Enemies downGeneral defeat!No more Grand Khotep...500 Enemies downSubprogrammed!Icessassinated! 30 55,78 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Melissa K. and the Heart of Gold Collector's Edition 26 -1 0 0,00 0 1.2407553196Been there, done that, got the T-RexInventory KingMay I Hint You?Gecko Says NoI Gotta Pea!Cruise ControlJournalist 26 41,24 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
METAL GEAR RISING: REVENGEANCE 60 1.7631406784JetstreamFangs of FuryWolf's PrideA Lover, Not a FighterThe Politics of Silencing FoesSurprise Attack!Genius Destroyer 49 45,04 81,7 1.6098037958Demilitarized ZoneTearing Away the DisguiseIch Liebe Kapitalismus!VR MasterVirtually FlawlessAmateur Radio OperatorYou're Hired 11 18,64 18,3
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
METAL GEAR SOLID V: GROUND ZEROES 16 0.6293609142GenesisDownfallReunion 3 1,42 18,8 0.9256598949InsigniaRescueSkilledDepthReminiscenceAccomplishedInfiltration 13 14,63 81,3
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
METAL GEAR SOLID V: THE PHANTOM PAIN 42 0.6721935868IntruderMan's Best FriendSkullImmortalVoicesReinforcementProsperity 22 8,93 52,4 0.5791153312War BuddyTruthApprenticeDisappearanceTrusty SteedHeroArmy 20 20,89 47,6
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Metro 2033 48 -1 0 0,00 0 0.3580887020First bloodNosalis hunterDemolitionistTank BusterExorcistRealistCowboy 48 57,88 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Millennium - A New Hope 52 -1 0 0,00 0 1.1904457808CuriosityGettin' On With the JobEverybody Has To StartDiscovering MystFairy WhisperThe First StepThe Examiner 52 98,60 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Minion Masters 38 -1 0 0,00 0 0.8983325958Ranked WinnerApprentice CollectionThe Stone LeagueRanked ConquerorSupreme!The Bronze LeagueCommon Crafter 38 49,74 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Monaco 13 -1 0 0,00 0 0.5851053596MassacreDem BonesWhackedTechnicianSlipperySilent WithdrawalI Work Alone 13 20,78 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Mortal Kombat X 73 0.5549702644So BoredBack It UpJumping BeanFINISH HIMPledge YourselfIt's a Gusher 6 2,05 8,2 0.3097410798Blanche AdvantageMoving UpHit the DojoTower KompetitorTerrifying EncounterStatistical AdvantageBrutal End 67 80,21 91,8
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Murderous Pursuits 145 -1 0 0,00 0 1.1932564974Blind-Eyed Mutton ShunterElementary My DearTaking The EggBatty-FangFloozyWindfallLevel 10 145 296,49 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
NeverEnd 21 -1 0 0,00 0 1.2942695618RespawnFirst BloodSonic HatShopperCardboard BoxWizard HatBeanie 21 41,26 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
NieR:Automata™ 47 0.6912701130What Are You Doing?Pod HunterCome Take a Look!Fighting's Not My ThingDesire Without EmotionOne Battle EndsIron Soul 18 6,17 38,3 0.4982015789A New Battle BeginsFinal WishTreacherous BladeFarewell, PascalJusticeCrime and PunishmentChip Collector 29 19,95 61,7
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Nightmares from the Deep: The Cursed Heart 15 -1 0 0,00 0 0.5433772206PLAYTIMELUCKY ROLLRULE O' THREESKULLDUGGERYCLOCKEDUNBURIED TREASURESURESHOT 15 11,56 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
NiGHTS into Dreams... 13 -1 0 0,00 0 1.3442324400the IDEALthe AFFECTIONHello Mepianthe POSSIBILITYthe CONSCIOUSNESSthe CONFUSIONthe REVIVAL 13 21,98 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Nioh: Complete Edition 79 -1 0 0,00 0 0.1884648949A Long Journey BeginsThe Beginning of a SamuraiSpa HealerThey Call Him AnjinLatest MasterpieceAn Agreement ForgedMaster of Chaos 79 69,61 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
No More Room in Hell 115 -1 0 0,00 0 0.4430424273Hands Off My ManProblem of InductionKevorkianHeroicsSocial ResponsibilityToofer Pt. 1Remove the Head, Destroy the Brain 115 208,65 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Nosgoth 80 -1 0 0,00 0 0.7958883643Expel the IrritantYour Right HandJust Don't Let Me Die As Food...A Shot in the DarkLethalityCarnageBlood Rain 80 178,28 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Nyctophobia 11 -1 0 0,00 0 1.3714922667TruckerWoodsmanFearlessCamperMaster of DarknessNotetakerBring the Light 11 17,28 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Obscure 19 1.0270850658Heavily armedThree with one blowPresent!Honor studentThe EndA stroll in the darkHall pass 15 11,98 78,9 1.2694895267Trigger happyMagna Cum LaudeBrutalWith Distinction 4 5,33 21,1
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Oddworld: Munch's Oddysee 38 -1 0 0,00 5,3 0.7250341177Spoocey!Leave the Cave.Spooced OutFuzzle Test Success!Very Spoocey!Vat'll do it!Fluoride Tanks 38-2 60,42 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Oddworld: Stranger's Wrath HD 36 -1 0 0,00 2,8 0.5421604514Bag Blisterz BootyStarting the JourneyWash my hands of this messClean the WaterToo Big For Your BridgesSpank that booty!Dumb it down 36-1 52,25 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Odysseus Kosmos and his Robot Quest - Episode 1 24 -1 0 0,00 0 1.5550489426Rifle on the wallKitty kitty, JoneseyE1 - done!Hit the papers!EliteMusophobiaTotal Recall 24 39,48 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Orbital Gear 12 -1 0 0,00 0 0.7636497021ShieldVendettaSupportKillerDeath From AboveEuthanasiaVolt Bringer 12 18,36 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Organic Panic 16 -1 0 0,00 0 1.8680280447Squash AchievementSmasher AchievementMaster AchievementSwimmer AchievementDrown AchievementLevitater AchievementBBQ Achievement 16 39,63 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Orwell 27 -1 0 0,00 0 0.6629538536Torture myself with whimsiesThe Clocks were Striking ThirteenA Place where there is No DarknessUnpersonWith powder and leadMemory HoleOne can deny me 27 29,63 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Outland 12 -1 0 0,00 0 1.1686406136That’s TeamworkEnthusiastEnvironmental ExterminatorDon’t Go AloneGrand MasterTwo BirdsOverkill 12 19,92 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Outlast 8 -1 0 0,00 0 0.6051685810ILLUMINATEDFLUSHEDSOAKEDEMANCIPATEDPUNISHEDEDUCATEDPULITZER 8 7,89 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Outlast: Whistleblower DLC 6 -1 0 0,00 0 0.8616974950GAS LEAKERSHOCKERWHISTLEBLOWERARCHIVISTLEGACYBOWELWHISTLER 6 6,80 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Painkiller Hell & Damnation 67 1.6590564251Soul RedeemerAdventurerSpeedSoul KeeperRageForgivenessEvil Eggs 37 40,45 55,2 1.0667563677Double HasteSurgeonName of the BeastHalloweenI have friendsHard-bittenJumping Death 30 48,37 44,8
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
PARTICLE MACE 21 -1 0 0,00 0 1.5677576065Killed By The SnitchPerfect CreditsMess With XMLUnlock All ShipsScore AsteroidScore EasyScore Hard 21 45,28 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Path of Exile 127 1.1110035181Raise the BarSaviourTreasure HunterDeadly SinsSin and SalvationRule of ThreeEternal Eclipse 37 26,63 29,1 0.8005118370Engulfed in FlamesGolden TouchCartographerBand TogetherSoothsayingFull Clear: ArchivesOne Small Step 90 114,55 70,9
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
PAYDAY 2 701 -1 0 0,00 0 0.1224777550No One Cared Who I Was...No Turning BackYou Gotta Start SomewhereHow Do You Like Me Now?Guilty of CrimeI Want to Get AwayWould You Like Your Receipt? 701 791,28 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
PAYDAY: The Heist 48 0.4971825778DiplomaticI ain't afraid no more 2 0,71 4,2 0.3217607141Eagle eyesCivil disobedienceCheney?Last ChristmasDodge this!Crack-bangIntimidating 46 60,54 95,8
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
PERFECT ANGLE: The puzzle game based on optical illusions 37 -1 0 0,00 0 0.8848751783AliceOlympic stadiumThe beachIdentityVanishedBad newsThe phone 37 44,50 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Persona 5 Strikers 47 1.0372906923No Looking BackThe Most Daring of AllDeath DefiedBest of the BestAll That GlittersMaster ThievesThose Who Heed the Call 44 29,62 93,6 1.1385655403Mask ConnoisseurEternal BondsTrue Phantom Thief 3 3,53 6,4
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Pid 12 -1 0 0,00 0 0.5803502202The first memoryYoung CartographerBothersome guestJunior ExplorerLittle guestGoodbye little guestSenior Explorer 12 20,42 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Pinball FX3 12 -1 0 0,00 0 0.7208428383Feel the powerMaster of pinballsLevel cap reachedBeat this!ArachnophobiaNine zerosGet the stars! 12 17,53 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Pixel Puzzles 2: Space 55 -1 0 0,00 0 0.9482629299Complete Puzzle 4Complete Puzzle 3Complete Puzzle 6Complete Puzzle 2Menu PuzzleComplete Puzzle 1Complete Puzzle 5 55 58,14 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Pixel Puzzles Traditional Jigsaw Puzzles 116 -1 0 0,00 0 1.4710267782Start Puzzling!Tutorial Complete!Puzzling Begins Here!100 PIECES PLACED!1st Puzzle Complete!First Flash!500 PIECES PLACED! 116 265,89 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Pixel Puzzles Ultimate Jigsaw Puzzles 595 -1 0 0,00 0 0.9697956443Puzzling Begins Here!1st Puzzle Complete!100 PIECES PLACED!Gotcha!500 PIECES PLACED!1st GOLD PIECE USED!1,000 PIECES PLACED! 595 1459,62 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Pixel Puzzles: Japan 26 -1 0 0,00 0 0.5464546084King FisherPuzzle 1 CompletePuzzle 2 CompletePuzzle 3 CompletePuzzle 4 CompletePuzzle 5 CompletePuzzle 6 Complete 26 18,90 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Pixel Puzzles: UndeadZ 30 -1 0 0,00 0 0.8546930552Puzzle 1 CompleteChomp ChompNade ThrowerPuzzle 2 CompletePuzzle 3 CompletePuzzle 4 CompletePuzzle 5 Complete 30 31,11 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Planetary Annihilation 19 -1 0 0,00 0 1.0937567949EfficientFully OperationalJack of All TradesWorldbuilderOne DownTechnophileAgainst All Odds 19 32,66 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Plunder Panic 22 -1 0 0,00 0 1.8576930761Getting Yer Sea LegsGlory to YeSeaworthyTaste of VictoryI'm the Captain NowDreaded PirateVictory on All Fronts 22 46,14 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Poker Night at the Inventory 20 0.4030978084Special Item: TychoSpecial Item: Strong BadSpecial Item: MaxSpecial Item: The Heavy 4 1,55 20 0.2623452246RushingWin A GameKicker TroubleStraightSummer of '69FlushTriple Through 16 7,84 80
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Pony Island 20 1.0318522453Ticket MasterGlitch CityI Am ErrorJiminy TicketThe TruthFor The CrusadeTicket Hunter 19 11,18 95 1.0629625320The Full Truth 1 1,06 5
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Portal 15 0.8096567988Vanilla Crazy CakeTerminal VelocityFruitcakeCupcakeFriendly FireHeartbreakerPartygoer 9 4,26 60 0.7094222307Long JumpTransmission ReceivedCamera ShyBasic ScienceRocket ScienceAperture Science 6 6,47 40
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Portal 2 51 0.9926604629OverclockerFinal TransmissionYou Made Your PointPturretdactylShip OverboardPreservation of MassDrop Box 23 10,07 45,1 0.2244960368High FiveTeam BuildingConfidence BuildingAir ShowScanned AloneBridge BuildingGesticul-8 28 21,57 54,9
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Portal Knights 29 0.4453779459FledglingLevel Up!TravellerBaby StepsMan Made 5 1,71 17,2 0.4202322066TinkererA HappeningLevel 10!ExterminatorDragon SlayerLevel 20!Adventurer 24 28,08 82,8
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Portal Stories: Mel 28 1.1794937849Under the StairsYou Shouldn't be HereIn the Vents2056Beyond your Range of HearingCrushedForever Alone 24 19,73 85,7 0.8883983493Story ShutdownCuriousPersistentSingle rainbow 4 4,21 14,3
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Press Any Button 5 -1 0 0,00 0 1.3517529964Thank You for Playing With MeIt's Quite an Achievement!You've Been Challenged EnoughYou Know Your SportWhat are You Trying to Achieve? 5 7,08 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Pressure 22 -1 0 0,00 0 1.0088628531MultiKillKing of the SkyPressure Is Low…Beginners' (Bad) LuckClick, Click, BoomFinished Laying PipesBad Pilot 22 33,39 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Prismata 114 -1 0 0,00 0 1.5507923365Outbreak CompleteDefenderOptimal BlockingSuper SpectatorSo Much DefenseBeginner Scenarios CompleteFlair Up 114 248,43 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Project Warlock 20 -1 0 0,00 0 0.6940666437Marco PoloSmall step for a Warlock...Ponce De LeonAh'n'gha throdog r'luhhorShadow of the EastMagellanWeird Cat 20 23,09 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Psychonauts 37 -1 0 0,00 0 0.6239226460Your Last Chance to Chicken OutA Victory for Good TasteJunior PSI CadetRolling Rock StarFor Insurance ReasonsRegular PSI CadetTime to Deliver the Milk 37 44,74 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Quake Champions 52 -1 0 0,00 1,9 0.4808969796First TasteVictoryEvil EyeBrickhouseHitmanSidekickUranium Slugger 52-1 89,60 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
QuestRun 13 -1 0 0,00 0 0.7272728682First Quest100 SpecialsFirst Hour100 Items100 EncountersAn Hour in Stance10k HP 13 16,65 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Quiplash 10 -1 0 0,00 0 0.9693880081Give It The FingersQuip It GoodQuipee-ki-yay!The Titular AchievementSitting OvationEighters Gonna EightHi, Jinx! 10 13,09 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Race The Sun 25 1.3294475079EagleFalconNighthawkKnightArmstrongRookSwallow 11 9,51 44 1.1124311686AldrinCirrusMontgolfierYeagerKingCumulusWright 14 25,86 56
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
RADical ROACH Remastered 35 -1 0 0,00 0 1.5488393307Now It StartsAnti Air AracnidsKill 100 MosquitoesFear Of ShadowsLizard TimeChameleon PopKill 100 Poppers 35 66,90 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Really Big Sky 20 -1 0 0,00 0 0.9493739605MR BLOBBYWAS RISKY500 KILLSCLOSE ENCOUNTERSMULTI X50LEVEL 5BOSS KILLA 20 33,37 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Red Risk 19 -1 0 0,00 0 1.0830813646SurvivorHunterRangerThinker100 InfectedTactical1000 seconds 19 29,29 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Reload 20 -1 0 0,00 0 0.7873620987Proven QuickshooterPaper BlasterCombo MasterProven HeadshooterWood BlasterChampion ShooterTarget Blaster 20 26,08 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Renegade Ops 12 -1 0 0,00 0 0.8511772156AirborneA Mess of Stiff Staff SergeantsFrom Cold Dead HandsJonesing for RelicsSupply ProblemsTo Hell and BackInferno's Briefs 12 18,11 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Reversion - The Escape 16 -1 0 0,00 0 0.6627428532IntroductionLady KillerSweet DreamsThe CaterpillarBig StickFunny ManNuisance guy 16 12,72 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
RunnerDot 2 -1 0 0,00 0 1.1185357571You've launched the game.Czech 2 2,32 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Sanctum 2 43 1.1696534157One shot, one kill.The Bas(e)icsCome at me bro!Mr. PerfectHumble Beginnings 5 2,97 11,6 0.4937849939The Best Defense is OffenseGibbs, gibbs everywhereCoffee StainedHalfway AwesomeGrowing StrongerHoney Badger don't careHercules 38 61,36 88,4
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Sang-Froid - Tales of Werewolves 33 -1 0 0,00 0 0.7002952099And It Starts!The TrapperYou Can Do It!The StrategistWerewolf HunterHear Something?Built to Last 33 51,27 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Saviors 100 -1 0 0,00 0 1.2746298313Unscathed And EasyNot Even CloseLow LevelEasy & EvilLevel UpUnscathed And NormalHigh Level 100 185,35 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
School Years 25 -1 0 0,00 0 1.5193951130Good personA long dreamDIYThe one in my heartAppointmentFirst giftPenpal 25 45,91 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Scrap Garden 42 -1 0 0,00 0 1.1587257385Press Start to playMy precious!Rookie MinerOops!It was an accident!AmanariumApprentice Miner 42 63,86 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
The Search 9 -1 0 0,00 0 1.0811522007Price of AdmissionPainterIron CrowTicket PainterCanvas RepairNew WorldThe Wasteland 9 10,93 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
SEGA Mega Drive & Genesis Classics 25 -1 0 0,00 0 1.4617167711500 Rings to Rule them AllWhat are the Buttons?Challenge AcceptedExtra HedgehogsFive LargeCommitmentExperiencing History 25 53,50 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Serious Sam Classics: Revolution 42 1.9954419136That all you got?The Good, the Bad and the EnormousYes, I'd like to kill more monstersDamagerChange of sceneryNo Fridge to HideA message to the stars 11 16,32 26,2 1.5682653189Going with the WindOnce Upon a Time in BabylonFriendly First EncounterMillion Funerals and No WeddingPlasma KingImpossibleThere used to be an alligator pit here 31 60,73 73,8
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Shadow Warrior 92 -1 0 0,00 0 0.4578120112Pot BreakerEnraged (Tier 1)Tiny GrasshopperAnarchist (Tier 1)BeheadedEnraged (Tier 2)Party Crasher 92 108,71 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Shadow Warrior Classic Redux 20 1.3408664465Family ReunionDisassemblyIn The Name Of The MoonUnder Every StoneUnfinished BusinessOops, My Bad!Speed Runner 20 21,96 100 100 0 0,00 0
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Shadows on the Vatican - Act I: Greed 20 -1 0 0,00 0 1.1078864336James Murphy, doctorThe game is onZen MasterCyberspace SurferItalian memoriesCheap JamesAttentive reader 20 26,99 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
ShipLord 9 -1 0 0,00 0 1.6514947414Boss fighter!Are you still counting those white balls?You're a hard nut to crack?Don't mess with the gravity too much.Upgrade master!Stop pulling stuff!Hidden stuff is the best stuff. 9 16,17 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Showing Tonight: Mindhunters Incident 13 -1 0 0,00 0 1.2181050777Beginner ShapesteinJunior SpectaculusBeginner PuzzlordAdvanced ShapesteinAdvanced PuzzlordProfessional ShapesteinSenior Spectaculus 13 18,85 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Shuyan Saga 20 -1 0 0,00 0 1.6730314493Kingdom's EndFamily MattersFriend in NeedLost in the MistKingdom ComeSerpent's TaleThe Champ 20 50,17 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
SIMULACRA 24 -1 0 0,00 0 0.7546650767You've got MailThe Gift of JabThe Internet Never ForgetsDerezzedAsk her anythingLooking for loveGossip Girl 24 28,81 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Sins of a Solar Empire: Rebellion 63 -1 0 0,00 0 0.8986809850Mutual TraderRoad to PeaceMetal MinerShip VisionaryPacifistPlanet VisionaryExport Maven 63 90,43 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Skyborn 24 -1 0 0,00 0 1.4741137028Patience is a virtueDab hand with those guns!Epic loots from jailEpic loots from the minesEpic loots from the mines againLaid out the LamiaDozed the Dozer 24 49,03 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Sniper Elite V2 41 -1 0 0,00 0 0.2909495831Front and CenterTrainee SniperNovice SniperMousetrap FuseEar PlugsDeadeyeDouble Dose 41 37,88 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Sonic Adventure™ 2 12 1.6456389427Emblem CollectorBoss AttackSpeedy RacerMission CompleteChao RaiserBeyond Good And EvilDARK! 10 12,32 83,3 1.4447602034Heaven or HellYou Are The Legend 2 3,32 16,7
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Sonic CD 12 1.6753548384Saviour of the PlanetJust in Time!Statue SaviourKing of the RingsTreasure HunterHeavy MetalTake the High Road 12 15,76 100 100 0 0,00 0
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Sonic Generations 49 1.5325906277(Hedge)Hogging It All Up!Mad SkillzRed Ring CollectorBig BangMission Accomplished!Secret SleuthColor Power! 47 43,56 95,9 1.5958820581Can't Touch ThisTime Attacker 2 3,23 4,1
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Sonic Mania 18 1.4763414860King of SpeedProfessional HedgehogCollect 'Em AllFull Medal JacketSecret SubCrate ExpectationsThe Password is "Special Stage" 17 18,94 94,4 1.5139094591No Way? No Way! 1 1,51 5,6
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Space Warp 22 -1 0 0,00 0 1.0313224792One Small StepNew RecordEarthNear MissGiving Up Is The Only Sure Way To FailReplaySolar System 22 43,98 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
SpaceChem 19 1.7084625959Distinguished Publication ReviewerChief Executive OfficerSenior Performance SpecialistJunior Publication ReviewerSenior Efficiency SpecialistMaterials Engineer of the PeopleCost Control Specialist 19 26,44 100 100 0 0,00 0
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
SpaceChem: 63 Corvi 1 0.0026021907Interstellar Transportation Specialist 1 0,00 100 100 0 0,00 0
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
SPACECOM 17 -1 0 0,00 0 1.4597666264Behind enemy linesNot built for the purposeTerritory ControlMultitaskingFull ServiceAnyone there?Just An Oversight 17 36,19 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Sparkle 3 Genesis 32 -1 0 0,00 0 1.0663117170NewbornDappledSunny BadgePredatorRed FactorAdolescentApprentice 32 52,51 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Spec Ops: The Line 50 -1 0 0,00 0 0.3424832225They LiveSpotterTreacherous GroundThe Lost BattalionDesert StormArmy of OneThe Horror 50 36,14 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Speed Kills 50 -1 0 0,00 0 1.3978767395Jesus Built My HotrodDamage DonePaint It BlackFast as a SharkIt’s a Long Way to the TopCrash & BurnGhost in the Ruins 50 102,80 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Spermination 16 -1 0 0,00 0 0.7559771538DiedDigestedPacifistGone Home5,000 Sperm Bank BucksConcieved100 Kills 16 21,44 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Spiral Knights 54 0.5693418384Expert SwordsmanGunslingerArmorerSwordsmanWelcome, StrangerFirst Steps 6 2,41 11,1 0.5258284807Mission AccomplishedJump StartHatterOne-Star SmithPharma SuitableExpert GunslingerStar-Spangled Bomber 48 53,21 88,9
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Splatter - Zombiecalypse Now 36 -1 0 0,00 0 0.7756003141First Steps into the RainCan't touch thisNothing in common but the enemyA surge of deepest satisfactionSeven at one strokeUltrakill!The crawling disease 36 43,57 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Squirrelmageddon! 82 -1 0 0,00 0 2.3514196873Rookie KillsBasic SquirrellingSurvivor KillsProven in the FieldVeteran SquirrellerLegendary SquirrellerWinter Wonderland 82 200,74 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
SteamWorld Dig 2 34 -1 0 0,00 0 0.6841530204The Guiding LightA Mysterious GardenA Shining CityCave DiverAt Least It’s ShinyThe EnlightenedIt Makes the World Go Round 34 40,22 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Stories: The Path of Destinies 37 -1 0 0,00 0 0.7586554885You know nothing Arctic Fox!New readerWhat does the fox choose?Show me your movesThe Good, the Bad and the GruntFinders keepersExcalibur? Nah! 37 40,10 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Streamline 49 -1 0 0,00 100 1.2072548866Shoulda DuckedPaparazziHang TimeSkin Of Your TeethRipperinoClothes 1Clothes 5 49-49 95,42 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
SUPER DISTRO 5 -1 0 0,00 0 0.8687950373First BloodLEVEL 1 COMPLETEDLEVEL 2 COMPLETEDLEVEL 3 COMPLETEDLEVEL 4 COMPLETED 5 7,77 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Super Meat Boy 48 1.0423552990The Fly guyLiving In the PastThe BootlickerI Have Crabs!The CommanderNostalgia 6 3,72 12,5 0.9247341752Metal HeadThe Jump manThe Kids Xmas!Old SchoolI Smell something Fishy...The EndWell look at you! 42 62,54 87,5
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Swipecart 20 -1 0 0,00 0 0.8722395301Fashion SenseChasing GoldCertified EngineerStylish CollectorEvent 1 CompletionBig SpenderMining Expert 20 39,08 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Swords and Soldiers HD 21 -1 0 0,00 0 0.8621057868Where are the Kangaroos?Vamos a la playa!Cooking by the BookAll I Want For Christmas Is YouV for VeggiesKeep Your Lousy ArmyI'm No Kung, Fool! 21 33,24 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
System Shock: Enhanced Edition 6 -1 0 0,00 0 1.4221535921HackerNice Jump, HumanIt’s OverUsing your HeadCan’t look at you, HackerLook at you, Hacker 6 11,41 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Tattletail 11 -1 0 0,00 0 0.7056356668Tattletail, That's Me!Uh Oh!Mama's Coming!Let's Play a Game!Mama Scary!We're Having a Party for Mama!Happy Birthday! 11 10,92 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Team Fortress 2 520 1.2422090769T-1000000Silicon SlaughterShowboatBank On ItNow Legal To EatHack of All TradesBombs Away! 388 239,37 75,4 0.4855316281PincushionDie Another WayOMGWTFBBQTriplecrossedSleeper AgentTriple StealFall Classic 132-4 123,39 24,6
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Teleglitch: Die More Edition 39 -1 0 0,00 0 0.6812912822Novice SurvivorDid Not Become Eaten by PlanktonLiving Meat beats Dead MeatBomberman IThe Firm Index FingerSteroid MonsterDeath Pudding Matador 39 75,77 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Tell Me Why 30 -1 0 0,00 0 1.0834112167Rear View MirrorHomecomingOne For The CollectionCrafty GoblinsBound To A LieChapter OneArborglyph 30 43,28 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Terraria 115 0.3762587309BenchedFashion StatementPretty in PinkLike a BossHeavy MetalWatch Your Step!Heart Breaker 14 3,31 12,2 0.2394463718Star PowerEye on YouBloodbathHold on Tight!It's Getting Hot in HereSmashing, Poppet!Jeepers Creepers 101 69,71 87,8
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Timberman 20 -1 0 0,00 0 0.4011680782Double TapAngel of AxeLittle ElfFaithfulTriple TapMultitreeJust Magic 20 21,55 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Tiny Bunny: Prologue 6 -1 0 0,00 0 0.6000808477Where are you, Vova?NeverlandCursed TapeUseful ConnectionsRun For Your LifeTrue Detective 6 4,12 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Titan Quest Anniversary Edition 76 -1 0 0,00 0 0.6248572469No burned village?It's dangerous to go alone.The first thresholdNobody did thisHearts of StoneTaste the beast!Found a bug 76 130,07 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Titan Souls 27 -1 0 0,00 0 0.6103903055First BloodOut of the Frying Pan......Into the FireTitan SoulLaser Eye SurgeryLeak SpinBeating the Yeti 27 42,59 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Toadled 24 -1 0 0,00 0 0.7248655558One Small Step For ToadToad, Evolve!Can’t Stop, Won’t StopThe Hunger AwakensIt’s A Toad Eat Dog WorldFour Heads Are Better Than One!Calorie Counting Be Damned 24 21,07 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Tomb Raider 50 -1 0 0,00 0 0.3786550164One Smart CookieBookwormPredatorSharp ShooterOpportunistGunslingerRelic Hunter 50 46,25 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Total War: SHOGUN 2 106 -1 0 0,00 0 0.5141085386Unnecessary ForceCommander of CommonersHead-HunterForged in the Hottest FlameRedoubtableBalanced AttackerElusive Strike force 106 167,16 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Tropico 4 60 -1 0 0,00 0 0.6577289701The Full MontyFilthy RichNational AgendaInstant ConstructionHeavy TrafficForeign CuisineYou are Fired! 60 74,04 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Turbo Pug DX 27 -1 0 0,00 0 0.7887458801First BloodSleeping with the FishesExplorerShockingly good!Is it a plane?TenacityMini Gamer 27 38,50 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Ultimate Arena 20 -1 0 0,00 0 1.1747059822Open Source Champion100 Fighters10 EventsShilling Pt. 1Shilling Pt. 2Call Me CrazyBig Kills 20 30,90 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Vertical Drop Heroes HD 30 -1 0 0,00 0 0.7046174407Beam Me Up!Let Me Out!Goblin Slayer!The Price of FreedomA Helping HandIt Wasn't Me!Weapon Unlocked: Crossbow! 30 36,17 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Viking: Battle for Asgard 50 -1 0 0,00 0 1.1877918243Viking ButcherThirst For BloodDemon HackerChampion of ChampionsBlinded To FearLust For BloodAssassin of Assassins 50 83,78 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Viscera Cleanup Detail: Santa's Rampage 13 0.5572435260Thunder Candle 1 0,56 7,7 0.6499920487The day the Funk DiedBloody IncompetentCleanliness is GodlinessSt. Nick's BoomstickThe Nose KnowsRooks KeptBallistic Weaponry 12 12,46 92,3
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Viscera Cleanup Detail: Shadow Warrior 2 -1 0 0,00 0 1.1061640978Sanitary SupremacyMr. Two Million Dollars 2 2,29 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Vox Populi Vox Dei 2 30 -1 0 0,00 0 0.9062961340First BloodFirst DeadAcupunctureDark KnightNo wrinklesRobin HoodIt hurts! 30 38,62 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Warframe 193 0.3786828816Tailor MadeInitiateWeaponsmithSpecial AgentWe Shape Our ToolsCounter IntelligenceNo Longer a Rookie 11 2,85 6,7 0.2858458757NesteggHookedBehold the PossibilitiesOur Tools Shape UsAngel of DeathGreater Than the SumAll for One 182-2 158,32 93,3
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Warhammer 40,000: Space Marine - Anniversary Edition 51 -1 0 0,00 0 0.4195021987The Might of the RighteousCommand SquadBlast RadiusInto the BreachDeath from AboveSilence the CannonPut Them Down 51 57,82 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Warhammer Underworlds - Shadespire Edition 38 -1 0 0,00 0 1.9618893862LuckyVery LuckyHeavy HitterRiggedGuidesKarmaChampion of Sigmar 38 84,06 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Whispering Willows 20 -1 0 0,00 0 0.7462081313First ContactI Ain't Afraid of No GhostGive them a HandFree BirdWhat Ghost Up Must Come DownItsy BitsyWhat Does the Fox Say? 20 20,35 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Wickland 5 -1 0 0,00 100 2.0219988823WandererTravelerSquireDiscipleMaster 5-5 10,75 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Wild Island Quest 13 -1 0 0,00 0 1.0595685244SurvivalistBoogeymanRead the books!Rampage UnlimitedSweet deathCome together!Brave heart 13 24,52 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Will Glow the Wisp 20 -1 0 0,00 0 1.2339537144BirthCrawlingStanding stillFirst stepFirst thoughtFive starsKindergarten 20 31,26 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
The Witcher 3: Wild Hunt 52 -1 0 0,00 0 0.2042560875Lilac and GooseberriesButcher of BlavikenLet's Cook!Fist of the South StarCan't Touch This!BookwormFamily Counselor 52 33,45 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
XCOM: Enemy Unknown 50 -1 0 0,00 0 0.1975706071We Happy FewWhat Wonders AwaitCombat ReadyAnd So It Begins…Eye in the SkyTables TurnedUp and Running 50 35,73 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Yelaxot 23 -1 0 0,00 0 1.4924044609Zayten EinsteinPower TabletAll Yelaxians Go to HeavenWelcome to Yelaxot!Blue Sacred StoneYelaxian WarriorGreen Sacred Stone 23 44,14 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Yet Another Zombie Defense 18 0.5718910098MajorCaptainLieutenantSergeantCorporalPrivate 6 2,70 33,3 0.7389994860ColonelCome get someBeginnerSaving upEfficient usageSurvivorKiting mastery 12 12,11 66,7
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Yury 14 -1 0 0,00 0 0.8847970366OXYGEN!OverheatSpace NinjaNow We're TalkingWings of RageRed & DodgyToo Big to Dodge 14 23,59 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Zero Gear 45 -1 0 0,00 0 0.5845156908Barrel RollFlippin AwesomeSlippy SezDouble FlipLemmingSting Like a BeeScrewed 45 63,12 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Zombie Panic! Source 106 2.3989367485Neville FlynnMultiple PersonalitiesStreets of DecayClaws and OrdureMore Than a Little TurbulenceSilent CruiseDead in the Water 10 19,66 9,4 1.8125244379Anti-VaccinationBad CropsBrainz COMBO to GoUnstoppable ClawsDead SnowSettling InChanging Sides 96 226,25 90,6
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Zoo Rampage 45 -1 0 0,00 0 0.5988697410First BloodRun For Your Life!I'm Gonna Be King Of Pride RockThat's A Big OneRampage Over 9000Stripes, Stripes EverywhereWhat A Mess 45 37,43 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle

Beta oyunlar

Oyun # Açılmış başarımlar Kilitli başarımlar
Şimdiki en iyi # Puan % Sonraki en kolay # Puan %
El Ninja (Beta) 6 -1 0 0,00 0 0.8346160650Ninja'dBlock'd!Professional NinjaFresh NinjaGODLIKE!A-MAZE-ING 6 5,74 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle

Spam oyunlar

Oyun # Açılmış başarımlar Kilitli başarımlar
Şimdiki en iyi # Puan % Sonraki en kolay # Puan %
Barro 109 -1 0 0,00 0 0.8444363475abcdefg 109 97,47 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Fruit Arranger 101 -1 0 0,00 0 0.8517304659start123456 101 97,50 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Ninja Stealth 5000 -1 0 0,00 0 0.9776364565Level 1Level 2Level 3Level 4One more...One more...One more... 5000 5507,79 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle
Polygoneer 40 -1 0 0,00 0 0.9091699123Level 1 15 secondsUnlock level 2Level 1 30 secondsLevel 1 60 seconds70 secondsLevel 1 3x comboLevel 2 15 seconds 40 44,10 100
Yalnızca bu tek oyuna ait başarım açma geçmişini görüntüle

Profil son güncelleme: 15 Temmuz 2022, saat 16:40.

Sonraki otomatik güncelleme 03 Mayıs 2025 tarihinde 11:11 zamanında yapılacak.

Achievement Stats 1.23-dev
372 sorgu çalıştırıldı
5817,05 KiB bellek kullanımı
20 gezici kullanılabilir

Yasal bilgi Gizlilik
Gizlilik Sözleşmesi
Powered by Steam